KEGG   Dinoponera quadriceps: 106742123Help
Entry
106742123         CDS       T05610                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II alpha chain isoform X1
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
dqu  Dinoponera quadriceps
Pathway
dqu04310  Wnt signaling pathway
dqu04745  Phototransduction - fly
Brite
KEGG Orthology (KO) [BR:dqu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106742123
 09150 Organismal Systems
  09157 Sensory system
   04745 Phototransduction - fly
    106742123
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dqu01001]
    106742123
Enzymes [BR:dqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     106742123
Protein kinases [BR:dqu01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   106742123
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CaMKII_AD Pkinase_Tyr DUF4440 SnoaL_3 Pkinase_fungal Kdo Kinase-like RIO1
Motif
Other DBs
NCBI-GeneID: 106742123
NCBI-ProteinID: XP_014470249
Position
Unknown
AA seq 583 aa AA seqDB search
MAVPAACTRFSDNYDLKEELGKGAFSVVRRCVQKSTGHEFAAKIINTKKLSNRDFQKLER
EARICRKLQHPNIVRLHDSIQEENFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQI
LESVHHCHHNGVVHRDLKPENLLLASKAKGAAVKLADFGLAIEVQGEAQAWYGFAGTPGY
LSPEVLKKEPYGKPVDIWACGVILYILLVGYPPFWDEDQHRLYAQIKAGSYDYPSPEWDT
VTPEAKNLINQMLTVNPGKRITASEALKHPWICQRERVASVVHRQETVDCLKKFNARRKL
KGAILTTMLATRNFSSKYDAQGRSIITKKGDGSQVKESTDSSTTIEDDDVKEDKKGGVDR
SSTVIAKEPEALGSLQGTPPSSPATMSAFSKAVGAATTMQANKQAGTGNPLGIAAVLLQG
TQEIRIVCPIKTCSQLSTNSQCSARRQEIIKMTEQLIESINTGDFEAYTKICDPHLTAFE
PEALGNLVEGMDFHKFYFDNAVLGKNCKAVNTTILNPHVHLLGEDAACIAYVRLTQYMDK
QGVAHTQQSEESRVWHKRDNKWQNVHFHRSAVTGPSPFSFNHK
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atggccgtgccagcggcttgcacgcggttcagtgacaactacgacttgaaggaggaactc
ggcaaaggtgccttctccgtggttcgacgatgcgtgcaaaagagcaccgggcatgaattt
gcggcaaagatcataaacaccaaaaagctttcaaacagagattttcaaaagcttgagcgt
gaagcacggatatgtagaaaacttcaacacccaaatatcgtgagattgcacgacagcata
caggaagagaattttcattatctcgtctttgacctagtcaccggcggagaactgttcgag
gacatcgttgcgagggagttctacagcgaggccgacgcctcgcactgtattcaacaaatc
ctcgaaagcgtacaccattgccatcacaacggagttgtgcaccgggatctgaaacccgaa
aatctgctcctcgcgagcaaagcgaaaggggcggctgtaaaactggcagacttcgggctg
gcgatcgaagtacagggtgaagcccaggcatggtatggtttcgctggaacgcccggctac
ctcagtccggaagtgttgaagaaagagccgtacgggaaaccggtcgacatctgggcgtgc
ggtgtcatcttgtacatcctcctcgtcggctacccgccattctgggacgaggatcagcat
cggctttacgcgcagatcaaggccggatcgtacgactacccgagtccagaatgggacacc
gtcacacccgaagccaaaaaccttatcaatcagatgctgacggtgaatccaggaaagagg
atcactgctagcgaagcactgaagcatccatggatctgccaacgtgagcgtgtcgcatcc
gtggtgcacagacaagagaccgtggactgcttgaagaaattcaacgcaaggcgcaagtta
aagggcgctatactgacgaccatgttggcgacgcggaacttttccagtaagtatgatgca
cagggtcgaagcatcataacgaagaagggcgatggctctcaagtgaaggaatccaccgat
agcagcacaacgattgaagacgatgacgttaaagaggataagaagggcggcgtcgaccgg
agcagcacggtcattgccaaagaacccgaagctcttggctcgttgcaaggtacacctccg
agcagccccgcgacaatgtccgccttctccaaggcggtcggcgcagccacgaccatgcaa
gcgaacaagcaggccggtacgggcaaccccctcggaatagccgcggttcttcttcaaggg
acccaagaaataagaatcgtgtgtcctatcaagacctgcagccagctctcgaccaactcc
cagtgctcagcgcgccgacaggaaatcatcaagatgaccgagcaattgatcgagagcatc
aacaccggagatttcgaggcgtacacgaaaatctgtgatccacacctgaccgcgttcgag
ccggaggctctaggtaatttagtcgagggaatggatttccacaaattttactttgataat
gcagtcctggggaagaactgtaaggccgtcaacacgacgatcctgaaccctcacgttcac
ctgctcggcgaggacgccgcatgcatcgcgtacgtcaggctgacgcaatacatggacaaa
caaggcgtagcgcacacacaacaaagtgaagaaagccgcgtgtggcacaagagggacaac
aagtggcaaaatgttcactttcatcgaagcgcggtgacaggcccgtcgccgttctccttc
aatcataaataa

DBGET integrated database retrieval system