KEGG   Dinoponera quadriceps: 106742584Help
Entry
106742584         CDS       T05610                                 

Definition
(RefSeq) protein henna isoform X1
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
dqu  Dinoponera quadriceps
Pathway
dqu00360  Phenylalanine metabolism
dqu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dqu00790  Folate biosynthesis
dqu01100  Metabolic pathways
dqu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dqu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    106742584
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    106742584
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    106742584
Enzymes [BR:dqu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     106742584
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Biopterin_H ACT
Motif
Other DBs
NCBI-GeneID: 106742584
NCBI-ProteinID: XP_014471176
Position
Unknown
AA seq 480 aa AA seqDB search
MYVQRTPQIEKLDQIKMPGQTKMPDQIEKGKYILDNTPPDTPKLIRGGNYIREGWDSAKS
ICLIFCPNEEDEIGSLGRYLQLFTEHKVNLLHIESRSSLRQPNGYEFMVECAPGGNITFV
IESLRSQCSYFSIISRNHRDNIDTVPWFPRRIRDLDKFANQILSYGAELDSDHPGFTDPV
YRKRRKYFADIAYHYKHGQPIPRVEYTPEEVATWGMVFRNLTKLYPKYACREHNHVFPLL
IENCGYREDNIPQLEDISNFLKDSTGFTLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHSS
KPLYTPEPDVCHEVLGHAPLFADPAFAQFSQTIGLASLGAPDDYIEKLATCFWFTVEYGI
CQQNGELKAYGAGLLSSFGELEYCLSGKPELQPFDPPKTALQKYPITEYQPVYFVAENFE
DAKEKMIKFAQTIPRKFGVRYDAYTQSISIIDSKQQVETLTNNLNQEVQILMDALKKLQH
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgtatgtccaaagaactccgcaaattgaaaagttggaccaaattaaaatgccgggccaa
actaaaatgccggatcaaattgaaaaggggaaatacattctggacaacacacccccagac
acgccaaaacttatccgtggcgggaattacatcagagaaggctgggactcggctaaaagc
atctgcttgattttctgtcccaacgaagaggacgaaattggctcgctgggacgatatctc
cagctctttaccgaacacaaagtgaatctcttacacatcgagtcccgaagttctctccga
caaccaaacggctatgaattcatggtggaatgcgcgccaggtggtaatatcactttcgtg
attgaatctctacgaagtcagtgcagctatttctcaataatttctagaaatcacagagac
aacatagacacagtgccgtggtttccccggaggatacgcgatctcgacaagttcgctaat
cagattctgtcatacggcgcagagctcgacagtgaccaccccggtttcaccgatcccgtg
tacaggaagagaagaaaatatttcgccgacatcgcttatcattacaaacacggacaacct
attccgagggtggagtacacgcccgaagaggtagccacatggggcatggtcttcaggaac
ctgacgaaactctatccgaaatacgcttgcagggaacacaatcacgttttcccattgctc
atcgagaattgtggttatcgtgaggataacattccccaactcgaggatatatcgaatttt
ttgaaagactccactggcttcacgctacgtccagtagcaggactgttgtcttcgcgcgat
tttctcgccggcttagccttcagggtgtttcacagcacgcagtacatacgacacagcagc
aaaccgctctacacgccggagccggatgtgtgccacgaggtcttaggtcacgcaccgctt
ttcgctgatccggcctttgcacagttctcgcaaaccattggtctggcctccctcggtgct
ccggacgattacatagagaaactcgcgacgtgcttttggttcacggtggaatacggaata
tgtcagcaaaatggggaattaaaggcctacggcgccggtctgctctcgtctttcggcgaa
ttggaatattgcctgagcggcaagccggaattgcaaccgtttgatccgccgaagacagct
ttgcaaaagtatccgataacggaatatcaacccgtatatttcgttgcggaaaacttcgag
gacgcgaaggagaagatgataaaattcgcgcaaactataccgaggaaattcggtgtcaga
tatgacgcttacacgcagagcatcagcattatcgatagcaaacaacaagtggagaccctt
acgaataacctgaatcaagaagtgcaaattctgatggacgctttgaagaaactgcagcac
taa

DBGET integrated database retrieval system