KEGG   Dinoponera quadriceps: 106744499Help
Entry
106744499         CDS       T05610                                 

Definition
(RefSeq) glutathione S-transferase-like isoform X1
  KO
K04097  prostaglandin-H2 D-isomerase / glutathione transferase [EC:5.3.99.2 2.5.1.18]
Organism
dqu  Dinoponera quadriceps
Pathway
dqu00480  Glutathione metabolism
dqu00590  Arachidonic acid metabolism
dqu00980  Metabolism of xenobiotics by cytochrome P450
dqu00982  Drug metabolism - cytochrome P450
dqu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dqu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    106744499
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    106744499
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    106744499
   00982 Drug metabolism - cytochrome P450
    106744499
Enzymes [BR:dqu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     106744499
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.99  Other intramolecular oxidoreductases
    5.3.99.2  prostaglandin-D synthase
     106744499
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C_3 GST_N GST_N_3 GST_C GST_N_2 GST_N_4 GST_C_2
Motif
Other DBs
NCBI-GeneID: 106744499
NCBI-ProteinID: XP_014474819
Position
Unknown
AA seq 207 aa AA seqDB search
MAEEQPRYKLIYFNARGRAEHIRYIFAYAGIDYIDERITNDRWPELKKSMPYGMLPVLEI
DGKPIAQSNAVARYLAREHNLAGKDEWESMLCDVLVDTLGDLKQFIFQYRTEEDLFKKEE
KKAKLLKETIPFYLNKFEQTVAENGGYAVGSTTTWADFVFTVALENFENIFGAMALDNYP
ALRGLKKRVHEISAIADWLARRPHSEF
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagagcagccgagatacaaattgatctacttcaacgcgcgaggtcgggccgag
cacattcgctacatattcgcctacgcgggcatcgactacatcgacgagaggatcaccaac
gatcgctggcccgagcttaagaagtcgatgccttacgggatgctgccggttctggagata
gacggcaagccgatagcgcagagcaatgccgtggcgcgttacctggctcgcgagcacaat
ctcgcaggcaaggacgaatgggaatcgatgctgtgcgatgttctggtcgatactttgggg
gacctgaaacaatttatttttcaatatcgcaccgaggaggatctttttaagaaagaggag
aagaaggcgaagctcctgaaggaaacgataccgttctacttgaataagttcgaacagact
gtcgctgaaaacggcggttacgcggtgggttctacgactacatgggcggactttgtgttc
acggtggcgttggaaaacttcgagaacattttcggggcgatggcgttggacaactatccg
gcgttacgcggcttgaagaaacgagtgcacgaaatttccgccatcgccgactggctggcc
aggcgaccccattcggagttctga

DBGET integrated database retrieval system