KEGG   Dinoponera quadriceps: 106745161Help
Entry
106745161         CDS       T05610                                 

Definition
(RefSeq) methionine--tRNA ligase, cytoplasmic isoform X1
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
dqu  Dinoponera quadriceps
Pathway
dqu00450  Selenocompound metabolism
dqu00970  Aminoacyl-tRNA biosynthesis
dqu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dqu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    106745161
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    106745161
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dqu01007]
    106745161
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dqu03016]
    106745161
Enzymes [BR:dqu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     106745161
Amino acid related enzymes [BR:dqu01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   106745161
Transfer RNA biogenesis [BR:dqu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    106745161
 Prokaryotic type
   Other AARSs
    106745161
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g WHEP-TRS GST_N_5 tRNA-synt_1 Anticodon_1
Motif
Other DBs
NCBI-GeneID: 106745161
NCBI-ProteinID: XP_014475976
Position
Unknown
AA seq 1000 aa AA seqDB search
MVTMNVSTNQGNPNALKLIIAAKLAQELVTVKIVEPKDAFLGRLPTLTTPSGLSLFSVSS
ALRLLLPVAAELEILNNKWLEWEISQLQPAILSYASGKTSSKDLLSLFKDLNSELKNKQY
LIETSSYLSPADISIWVSLWSTLLFAECKDISAQLLNIVHWLTNMEQQPVIQESIKEFDL
VRGAKAIASIEAASWFPVNAVTNAQVRQESLLSDISPTKEKEMETVSQEEVRSVMNIWFT
RRYPEVKESSYPILPKKGERNVLVTSALPYVNNVPHLGNIIGCVLSADIFARYCRQRNYN
TLYISGTDEYGTATEAKALQEKTTPQIICDKFFDIHNDVYRWFGIGFDYFGRTTTPEQTE
IVQSFFLKIKSQGYILNESVEQLHCEFCDRFLADRFVEGTCPRCKYEDARGDQCDGCSHL
VNAVELIEPRCKMCNTKPVVRNSVQFFLDLPKLEDKLKQWSATVNQGWSSVAKVVSKSWL
RDGLKPRCITRDLKWGIPVPVNGFENKVFYVWFDAPFGYVSITKRYTKEYEKWWKPQDTK
VDLCQFMAKDNVPFHAIMFPACLLAANQNNTMIKYLMATEYLNYEDKKFSKSRGIGVFGT
DARDTGIPADVWRFYLAYIRPETQDSNFNWIDLATKNNSELLNNLGNFVNRALMFSEKFF
DSNVPPMKLEEADWIVLALAQRELSSYISAMEQAKLRDGLKYILAISKHGNQYMQFQQPW
VKIKGTDDDKNRAGTVVAICCNLACLLSALLAPFMPTTAKQLRSQLGLSNKSYGYIPETI
TNMLPTWHKIGKPSPLFTKIEEQQVEMLRKKYAGQQEINGRTAATNVASDESVDSLETAI
MVQGNLVRELKAKHEKSVWQPQVEILLSLKKKLADLKVSAPKAPEKNSPVKNKKVETNVN
KQHARLYEQKISDLKALHSAINERRLKESKKDAVGNAATDVATLESAIAKQSNLVRELKA
KGDANVWEPQVEMLLKLKEQLMGLTEATPVAVDKKSKKKK
NT seq 3003 nt NT seq  +upstreamnt  +downstreamnt
atggtaacgatgaacgtctcaacgaaccagggcaacccaaacgcgttaaaactaatcatc
gcggctaaattagcccaagaacttgtcaccgttaaaatcgtggagcccaaagacgctttc
ctaggacgcttgccgacgttaactacgccgtcaggattatccttattcagtgtctcctcg
gcgttacgcttgctgttgcctgtagccgctgaattagagattcttaataataagtggttg
gaatgggaaatttctcaattacagccagcaatattaagttatgcaagtggaaaaacttca
tccaaggacttattgtctttgttcaaagatctcaatagtgaattaaaaaataagcagtac
ttaatcgagacaagtagttatttatcaccagcagatatttctatttgggttagcttgtgg
agtactctattatttgcagaatgcaaagatatttcagcacagttgctaaatatcgttcac
tggctgactaacatggagcagcaaccagttattcaggaatctattaaagaatttgacttg
gtgagaggtgcaaaagcaattgcaagcatagaagctgcttcatggtttcctgtcaatgca
gttacaaatgcccaagttcgtcaagagtcattattaagtgacattagtcctaccaaggaa
aaggagatggaaactgttagtcaagaagaagtacgcagtgtgatgaatatttggttcact
cgacgatatccagaagtcaaggaaagttcatacccaatactgcccaagaaaggcgagagg
aatgtattagtgacatcggctcttccttatgtaaataatgttcctcatttggggaatatc
atcggttgcgttctctcagccgacatctttgcaagatattgcagacaaaggaattacaac
accctctacataagcggcaccgacgagtacggcactgcgaccgaagcgaaagccctgcaa
gagaaaactactcctcaaattatctgcgacaagttcttcgatatacacaacgatgtttat
cgctggttcggcattggattcgactatttcggacgcaccactacgcccgagcagacggaa
attgttcaatcgtttttcctgaagatcaagtcgcaagggtacatattgaacgagagcgtg
gagcagttgcactgcgaattctgcgatcgatttctcgccgatagattcgtggagggcacg
tgtcccaggtgcaagtacgaggacgcgcgtggtgatcagtgcgacggctgcagtcatctg
gtgaacgcggtcgaattgatcgagccacgatgcaagatgtgcaacaccaaacccgtcgtt
aggaattcagtacaattcttcctggatttgcctaagttggaagataaactgaaacaatgg
tctgcgacggtgaaccaaggatggtccagcgtcgcgaaagtcgtctcgaagtcgtggtta
cgcgacggccttaagccgcgctgcataaccagagacctgaagtggggtataccggtgccc
gtaaacgggttcgaaaataaagtgttttacgtctggtttgacgcccctttcggatatgtc
agtattactaagaggtataccaaagaatatgagaaatggtggaaacctcaggatacgaaa
gtcgatttgtgccagtttatggcgaaggataacgttccattccacgcgataatgttcccc
gcttgcttgctagcggctaatcaaaataatacgatgatcaagtatttaatggcaactgag
tatctaaattacgaggataaaaagttttccaaatctagaggcatcggagtatttggaacc
gatgcaagagatactggaatcccagcggacgtgtggcgattctatttagcctatattaga
cccgaaactcaagattccaatttcaattggatagatctggccacgaagaacaatagcgag
ctactgaataatcttggcaatttcgtcaatagagctctgatgttctccgagaaattcttc
gactccaatgtgccgccgatgaagctagaagaggccgattggattgtgttggcgttggca
caacgcgaactgtcgtcctacataagcgccatggagcaagccaagttgagagacggcctg
aagtacatactggcgatctcgaagcatggcaatcagtatatgcagttccagcaaccgtgg
gtgaaaatcaagggcaccgacgacgacaagaatagagccggaaccgttgttgcaatttgc
tgcaatctagcatgtcttctgtcggctctgctggctcctttcatgcccaccaccgctaag
caattgagatctcagttgggcttgagcaacaagagctacggttatatccccgagacgata
acgaacatgttgcccacttggcacaaaattggcaagcccagcccgttgttcacgaaaatc
gaagaacagcaggtggagatgttacggaagaaatacgccggacagcaggagatcaacggg
cgtacagcggcaacgaatgtggcctccgacgaaagtgtcgattctcttgaaactgccatc
atggtgcaaggtaatctggttagagagctgaaagcgaagcacgagaagagcgtttggcag
cctcaggtggagatcctgttgagcttgaagaagaagcttgccgatttgaaggtcagcgcg
ccgaaggcgcctgaaaaaaactcacccgtgaagaataagaaggtcgagacaaacgtgaat
aagcagcatgcacgcctctacgaacaaaaaattagcgacctcaaggccttgcactctgcc
attaatgaaaggagactaaaagaatcgaagaaggatgctgtcgggaatgctgcgacggac
gtggcgacgttggaatcggctatcgcgaaacagagcaatctcgtgcgagagttaaaggct
aagggagacgcgaacgtgtgggagccgcaagtggagatgttattgaaactgaaggaacag
ctgatgggtctcactgaagcaacgccagtcgccgtcgataagaagtccaagaagaaaaag
taa

DBGET integrated database retrieval system