KEGG   Dinoponera quadriceps: 106745690Help
Entry
106745690         CDS       T05610                                 

Definition
(RefSeq) aromatic-L-amino-acid decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
dqu  Dinoponera quadriceps
Pathway
dqu00350  Tyrosine metabolism
dqu00360  Phenylalanine metabolism
dqu00380  Tryptophan metabolism
dqu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dqu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    106745690
   00360 Phenylalanine metabolism
    106745690
   00380 Tryptophan metabolism
    106745690
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dqu04147]
    106745690
Enzymes [BR:dqu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     106745690
    4.1.1.105  L-tryptophan decarboxylase
     106745690
Exosome [BR:dqu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106745690
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase DUF5601 YmgD
Motif
Other DBs
NCBI-GeneID: 106745690
NCBI-ProteinID: XP_014477016
Position
Unknown
AA seq 480 aa AA seqDB search
MDSDNFKDFAKEMAEYITNYMQNIRDRRVLPTVEPGYMKPLLPSEAPQSPEEWKDIMADI
ERVIMPGVTHWHSPKFHAYFPTAQSYPAIVADMLSGAIACVGFSWIASPACTELEVIMLD
WLGKMIDLPKEFLACSGGKGGGVIQGTASEASLVALLGAKAKKLKQVKEQHPEWTNPEII
DKLIAYCSCQAHSSVERAGLFGGVKFRLLPVDEKCKLRGDVLAKAIQEDKEKGLIPFYVV
ATLGTTVSCAFDRLDEMGVVANREDVWLHVDAAYAGSAFICPEYRYLMKGIELADSYNFN
PHKWMLVNFDCSAMWLKDPTYVINAFNVDPLYLKYDTQGSAPDYRHWQIPLGRRFRSLKL
WFVLRLYGIENLQKYIRKHIAQAHEFEAMVLTDPRFEIVAEVLMGLVCFRLKGSNDLNEA
LLKRINGAGNIHLVPSKINDMFFLRLSICSRYSESKDIEYSWKEIKLRANEVLEEQSVSK
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggattccgataatttcaaggactttgccaaggagatggcggaatacatcacaaattat
atgcagaacattagagacagacgagtgttgcctacagtggaaccaggatatatgaagccc
cttttaccttccgaagcgccgcaaagccccgaagaatggaaagatattatggccgacata
gagagggtgataatgccaggtgttacacactggcacagcccgaaattccacgcgtacttt
cccaccgcgcaatcatatcctgctattgtggctgacatgttaagcggagctatcgcgtgc
gtcggattctcgtggatagcgagtcccgcctgtactgagttggaggtgataatgctagat
tggttagggaaaatgatagatctgccgaaggaatttctcgcctgcagcggtggcaaaggt
ggcggtgttattcagggaactgccagcgaagcttccttggtcgcgttactaggagcgaaa
gccaagaaactgaaacaagtcaaggagcaacatcccgaatggacgaatcctgagatcatc
gacaaacttatcgcgtactgttcctgtcaagcgcacagctcggtggaacgggccggactt
ttcggcggagtaaaattccgactattgccggtcgatgagaagtgtaagcttcggggcgac
gtattggcgaaggcgattcaagaagataaggagaaggggcttataccgttctacgttgtc
gctactttgggtaccaccgtttcctgcgccttcgatcgtctcgacgaaatgggcgttgtg
gcgaatcgcgaggacgtttggctgcacgtggatgccgcttacgcaggctccgcgttcatc
tgtccggaataccgatacttgatgaaaggtatcgagctggcggactcgtacaactttaac
ccgcacaaatggatgttggtaaatttcgactgctccgctatgtggctcaaggacccgacc
tacgtcataaatgctttcaacgttgatcctttgtacctgaagtacgatacgcagggctca
gcgccggattacaggcattggcagatcccactcggccgtagattccgctctctgaagctc
tggttcgtactgaggctctacgggatagagaatctccagaagtacattagaaagcacatc
gctcaagcgcacgagttcgaggcgatggttctcaccgatccccgcttcgagattgtcgcc
gaagttctcatgggactggtttgcttccgtttaaagggttccaacgatctcaacgaggct
ctcttgaagaggatcaacggcgccggaaacatccatctcgtcccgtccaagataaacgat
atgttcttcctgcgattatccatctgttctcgatacagcgagagcaaggacatagagtat
tcctggaaggagatcaagctgagagccaacgaggtcctcgaggagcaatcggtctcaaag
tga

DBGET integrated database retrieval system