KEGG   Dinoponera quadriceps: 106745953Help
Entry
106745953         CDS       T05610                                 

Definition
(RefSeq) retinal guanylyl cyclase 2 isoform X1
  KO
K12322  guanylate cyclase 2F [EC:4.6.1.2]
Organism
dqu  Dinoponera quadriceps
Pathway
dqu00230  Purine metabolism
dqu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dqu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    106745953
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dqu01001]
    106745953
Enzymes [BR:dqu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     106745953
Protein kinases [BR:dqu01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   106745953
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc Pkinase_Tyr Pkinase ANF_receptor HNOBA
Motif
Other DBs
NCBI-GeneID: 106745953
NCBI-ProteinID: XP_014477505
Position
Unknown
AA seq 1375 aa AA seqDB search
MAGNCFRQFWWWIPIAILSRCILPSSAGRISCTSTYPSEMAHGQTRSDADVIVFLGERCD
WEINVTEIQDHLERAPDAGELSISVMPRSLTCETKTGGLGALIHALGESKTKAVIAALDS
SICEVAAKLAYLGNKPLLTWTCPLRDSTEREHSSIIRLSPSLPSMANAVAEIFLHLQWKT
AAIIGTDREPWSSLDRAVISAFRRIGVVLRYHLILPRHATLEQIRRILKSLHSVSRRATV
LCLPLFDEMTNRVLIELDVAWQTHIQNSVILMIHTEDIDLFLPEDDSPTSLTTDPSTLAH
FAITQSSNFSTSNITRNSRYATPQDDEGVRRVQTPRRFFPPRNLSSATTENLVAVAPLDQ
RYDVRKVFNGTQDYATVALLDRLNESLAVLTRDNSSIDSHNNKMYTYALMDWRDTGWEPI
LAVVERHQRLLVQQLTPSAVAFLNVESPDLLSCDDDADCGAGGLADMSFRITHIVAIILG
SLLFTFVTIAIAIIVRKHLIKKRMSKGPYKIILTTSDFVFPQVPPVDSRTVDEGIEAMLC
CWLQQLQEFGGPEVEKPDLLQLGSVNSLRPYLQANSGNLPRHTFFKDPRARYNGDLVQLK
ELPVQGTFELKNKAMDVLVTIHGLRHENLNPLIGCLNEPTRPCLVSEYCSRGSLEDVLVQ
DEIKLDWSFRLSLLTDLVRGMKYLHGTPMRVHGYLTSRNCVIDARWVLKVTDYGLPAFYE
AQNIVPPTKTARDLLWTAPELLRHPNLQKKGTQPGDVYSFGIIMQEVVVRGEPFCMLALS
PEDIIEKVMKPPPLIRPSVSKGAAPPEAINIMRQCWAETEEMRPDFDDVHDLFKKLNHGR
KVNFVDTMFQMLEKYSNNLEELIRERTEQLDMEKKKTEQLLNRMLPSSVAEKLKLGMPVD
PEEFREVTIYFSDIVGFTTISARSTPFQVVDLLNDLYTCFDDTINAYTVYKVETIGDAYM
VVGGCPVRIPDHASQVATMALDLLHQSGKFKLKHLPDTPLRLRIGLHTGPCCAGVVGLTM
PRYCLFGDTVNTASRMESTGAPWRIHLSQATRDRLTQVGEYHIEYRGPTDVKGKGKMPTY
WLLGKQGFDKELPRPPPLGENHGRDESLTLESHQSGLSSDSAGSQLPVIPSQDDTHEEPE
IAVEATVNRDDSVSSGLANSDSRAGSFEEAGTRKVAVSVHDERTLLSSYSLKSNNDFIEV
LSGRQDTVTKTCESHGVTKSTSGDTQVSLGMSSGGEPTSTVLGASTSSLTSIASSATYRQ
PPRFRRLAGCIDEKDLSTPYNYYRCLSPNEHHGKGPGCRILKRQFSLDRPDEPTSAISEQ
SSSQRSAPRLYKQNSAGAANDLERIEEVPATPGPLLQNYRNAASVSLSVESLSLR
NT seq 4128 nt NT seq  +upstreamnt  +downstreamnt
atggccgggaattgttttcgtcagttctggtggtggatcccgatcgcgatcctatcccgg
tgcattcttccctcctcggccggtcgtatttcgtgcacgtccacctatccttcggagatg
gcccacgggcaaacccggtccgacgcggacgtaatagtcttcctgggcgagagatgcgac
tgggagatcaacgtcaccgagatacaggatcacttggagcgcgcgccggacgccggcgag
ctctcgatcagcgtgatgccaagatccctaacgtgtgagacgaagaccggcggcctgggc
gccctgatccacgctttgggcgaaagcaaaacgaaggcagtgatagcggcgctcgacagc
tcgatttgcgaggtggcggccaagctcgcgtatcttgggaataaaccgttgctcacttgg
acctgcccgctgagagattcgacggagagggaacactcatcgatcattaggctttctccg
tcactgccgtcgatggccaatgccgtggcggaaatattcctacatctgcagtggaaaacc
gcggctatcatcggtaccgatcgcgagccgtggtccagcctggaccgcgccgtgatcagc
gcttttcgaaggatcggcgtcgtcctgcggtaccatttgattctaccccgtcacgccacc
ctcgagcaaattcgcagaatcctgaagtccttgcacagcgtctcgcgtcgagccacggtg
ctctgcctgccgctatttgacgagatgacgaatcgcgttctgatcgagctggacgtcgcc
tggcaaacgcacatccagaactccgtcatcctgatgatccacacggaggatatcgacttg
ttcctcccggaggacgactcgccgacctcgcttaccaccgatccatcgaccttggcacat
ttcgcgattactcagtcttccaatttttctacgtcgaacataactcgcaatagtcggtac
gcaactccgcaggacgacgagggggtgcggagggtgcaaactccgcggagattcttcccg
ccgagaaacctcagcagtgccacgacggagaacctagtcgcggtcgcgccactcgatcaa
aggtacgacgtgcgaaaggtcttcaacggcacgcaggattacgcgacggtggcgttgctc
gaccggctgaacgagtcgctggccgtgctgacgcgcgacaacagcagtatcgacagccac
aacaacaaaatgtacacgtacgccctaatggactggcgcgacaccggctgggagccgatt
ctcgcggtggtcgagcggcatcagcggttgctggtccaacagctgacgccgagcgcggtg
gcgttcctcaacgtcgagagccccgatctgctgtcctgcgacgacgacgccgactgcggg
gcaggtggcttggccgacatgtctttccgcatcacacatatcgtagctattattctgggg
tcgctgctgttcacctttgtcaccatcgccatcgcgattatagtccggaagcacctgatc
aagaagaggatgtccaaggggccgtacaaaatcatcctgacgacgtcggacttcgttttc
cctcaagtgcctccagtagattcgagaacggtagacgagggcatcgaggcgatgctgtgc
tgctggctgcagcagctgcaggagttcggcggcccggaagtcgagaagccggatctgctc
cagctgggaagcgtgaactccctcaggccttacttgcaggccaacagcgggaatttgccg
cggcacactttcttcaaggatccacgcgccaggtataacggtgacttggtgcaactgaag
gagctgcccgttcaaggtacgttcgaactgaagaacaaggccatggacgtgctggtcacg
attcacgggctgcggcacgagaacctcaatcccctgattggatgccttaacgaacctacg
agaccttgcctagtgtcggaatattgttcgaggggctccctggaggacgtgcttgtccaa
gacgagatcaaactcgactggtctttcagattatccctgctcaccgatctcgtgcggggg
atgaaatacctgcatggcaccccgatgcgtgttcacggctatctcacttcgcgcaactgc
gtgatcgacgcgagatgggtcttgaaagtcaccgattacggcctgcctgcgttttatgaa
gcacagaacatagtaccaccgactaaaacagctcgggacctgttatggaccgcgccggaa
ctgcttaggcacccgaatctgcagaaaaaggggacccaaccgggagacgtttacagtttc
ggaattattatgcaggaagtcgttgtccgcggagaaccgttttgtatgctcgccctgtct
ccggaagatataatcgagaaagtgatgaagccaccgccgctaatcagaccgtcggtcagc
aagggtgctgcaccgccggaagccataaacatcatgcgccagtgttgggcggaaactgag
gagatgagaccggactttgacgacgtgcacgatctcttcaagaagctcaatcacggaaga
aaagtgaacttcgtggacacgatgttccaaatgctcgagaagtactctaacaacctggag
gaactcattcgcgagcgtaccgagcagctcgacatggagaagaaaaagactgagcaattg
ttgaacagaatgctgcctagctcggtcgcggaaaaactgaagctcggcatgccggtcgac
cccgaggagtttcgcgaggtcacgatttacttctcggacatcgtcggcttcacgacgata
tccgcgcgctcgacgccctttcaggtggtcgatctcctcaacgatctgtacacttgtttc
gacgacacaattaacgcgtacacggtctacaaggtggaaactattggtgacgcttacatg
gtcgtgggtggctgtcccgtgagaatacccgatcacgcgtcccaagtagcgaccatggcg
cttgacctgctgcaccagagcggaaagttcaagctaaaacatctgccggacacgccgctc
cggctacgcatcggtcttcatacgggcccatgctgtgccggcgtggtggggctaacgatg
ccgcgttattgcctcttcggcgacacggtgaacaccgcctcgaggatggagtcgaccggc
gcgccgtggcgtatccatctcagccaggcgacgagagatcgattgacgcaggtcggcgaa
taccacattgaataccgcgggcccaccgatgtcaaggggaaaggcaagatgccgacctac
tggctgctcggcaagcaaggcttcgacaaggagctgcccaggccgccgcccctcggggag
aaccacgggcgcgacgagagcctgaccctggagagccaccagagcggattgtcgagcgac
tcagctggctcgcaattgccggtgatcccgtcgcaggacgatacgcacgaggagccagag
atagcggtcgaggccacggtcaacagggacgactcagtcagcagcgggttagctaacagc
gacagtcgagccgggtccttcgaagaggccggcaccaggaaggtcgccgtttccgtgcac
gacgaacgcacgttgctgtccagttactccttgaagtctaacaacgacttcatcgaggtg
ctgtcgggaagacaagacacggtcaccaagacgtgcgagtctcacggcgtaaccaagagc
acatccggcgatacccaggtctccctcgggatgtcgtccggcggcgagccgacgtcaacg
gtcctcggcgcgtccaccagctcgctcacgtcgatcgccagctcggcgacgtaccgacaa
ccgccgaggtttcgaaggctcgccggctgcatagacgagaaagacctcagcacgccgtac
aactactacagatgtctgtcgcccaacgagcatcacgggaaaggtcccggatgccggata
ctcaagaggcaattcagtctggaccgtccggacgagccgacgtcggcaatctcggagcag
tctagcagccagagatcggcgcctcgtctctacaagcaaaacagcgcaggcgcggccaac
gacttggagaggatcgaggaggtgccggccacccctggacctcttcttcagaactatcgt
aacgccgcttcggtttccctctccgtcgagtcgctctcgttacgctga

DBGET integrated database retrieval system