KEGG   Dinoponera quadriceps: 106746364Help
Entry
106746364         CDS       T05610                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
dqu  Dinoponera quadriceps
Pathway
dqu00010  Glycolysis / Gluconeogenesis
dqu00562  Inositol phosphate metabolism
dqu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dqu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106746364
   00562 Inositol phosphate metabolism
    106746364
Enzymes [BR:dqu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     106746364
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     106746364
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 106746364
NCBI-ProteinID: XP_014478397
Position
Unknown
AA seq 442 aa AA seqDB search
MFWKLVAEIVLLCIINISLASNSSMKDNIYKCKLGSKTPYRCVANYNDTPMKYSGCVEKK
IWLLLRHGTRYPGKKYIPRMLEELPKLQHIILENYENGKTRLSANDAILFKEWRPKLTLN
DMMKLTTEGENEMISLGERYQARFPSLMPEIYSNQTYKFRYTLTQRTEESARHFAAGLFG
WRSSQNVLYPEPVYRDPILRFYKACPRWRQEVDKNPNAIVEKRKFLKSKTVIDMLDNIKN
FIGHSVNYESAHLMHTMCAFETAWEQNVISPWCKIFSLNDFKVFEFAEDIEYYWIDGYGY
RLTYEQACSALKDMFDFFASKESPITTAYFTHSGTILKLLALLGVAKDTHPLMHDSFASH
ENDKREWKSSIIDVFASNIAFVLYDCTSQGLSILFMFQERPLYLPNCPSDMPCPMATMKM
AYPDSDEECQFDAMCHVSTQEN
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgttttggaaactggttgctgagattgttttactgtgtataataaatatttctcttgct
tccaattcttccatgaaagataatatatacaaatgtaaattaggatccaaaactccatat
agatgtgtagctaattataatgatacaccgatgaaatactcaggttgtgtagaaaagaaa
atctggttgcttctacggcatgggactcggtatccaggcaaaaagtacatacctcgtatg
ctagaagaattaccaaaattgcaacatataatattagaaaattacgaaaatggtaaaaca
agactgtcagctaatgatgcaatattgttcaaagaatggagaccaaaattgactttgaat
gatatgatgaaattaacaacagaaggagaaaatgaaatgatcagtcttggggagaggtat
caggcaagatttccatctctaatgccagaaatctacagcaatcagacctacaaatttaga
tacacattgactcaacgtacagaggagagcgcaagacacttcgctgctgggttatttggt
tggcgaagtagtcaaaacgttttgtatccagaaccagtatatagagacccaatactaaga
ttttacaaagcctgtcctcgctggcgtcaagaagttgacaagaatccaaatgcaatagta
gagaagagaaaatttttgaagagcaagactgttattgatatgttagataatattaaaaac
tttatcggccacagtgtcaattatgaaagtgcacatttaatgcataccatgtgtgccttt
gagactgcttgggagcaaaatgtaatatctccctggtgtaagatattttccttaaatgat
ttcaaggtatttgaatttgcagaagatatagaatattattggatcgatggatatggatat
cggttgacttatgagcaagcatgttctgccttaaaagacatgttcgactttttcgcgtcc
aaggaaagcccaataacaacagcttattttacacattctggaacaattctcaagttattg
gctttgcttggagtggctaaagatacacatcctttgatgcacgattcttttgcatcgcac
gagaatgataagagagaatggaaaagtagtattattgatgtatttgcatccaacatcgca
ttcgttttatatgattgcacatctcaaggtctcagtattttattcatgtttcaagaacga
ccgttgtatttgccaaactgcccaagtgacatgccatgcccaatggctactatgaagatg
gcatatcctgatagcgatgaggaatgtcaatttgatgctatgtgccatgtgtcaacacaa
gaaaattga

DBGET integrated database retrieval system