KEGG   Dinoponera quadriceps: 106747277Help
Entry
106747277         CDS       T05610                                 

Definition
(RefSeq) exportin-5
  KO
K14289  exportin-5
Organism
dqu  Dinoponera quadriceps
Pathway
dqu03013  RNA transport
Brite
KEGG Orthology (KO) [BR:dqu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    106747277
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dqu03016]
    106747277
   03036 Chromosome and associated proteins [BR:dqu03036]
    106747277
Transfer RNA biogenesis [BR:dqu03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    106747277
Chromosome and associated proteins [BR:dqu03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Other miRNA pathway proteins
     106747277
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Xpo1 IBN_N
Motif
Other DBs
NCBI-GeneID: 106747277
NCBI-ProteinID: XP_014480136
Position
Unknown
AA seq 1216 aa AA seqDB search
MEFGAGDVAQISAELAGVVEVMMSPDVPQEQRLEVYNACERFKESSPLCAQCGLYLAQKS
PNRSSVVRHFGLQLMEHCVKYRWTQISQSEKIFIKENAMKLLQEGTEPLLQEEAHIKDAL
SRVVVEMIKREWPQQWPTLLAELCQACTRGESQTELVLLVFLRLVEDVALLQTLESNQRR
KDIYQALTTNMAEIFSFFLRLMEQHFSEFQKKSALGQMSDAAAHSKVVQVVLSTLTGFVE
WVSINHVMAEDGRLLQILCLLLGNPIFQCSAAECLLQIVNRKGKAEDRKQLMILFSEEAL
RCIYTAATSPPPLTGPTTNENHYLFLKKLTQVLTGMATQLCTLWGKDDASSIRPTHFNIF
LDTVLTFTMYSSLTLTHLANAIWVMLFKHEQIKTDSLLLTYVPKYVENTAPKLIKVAYPH
SRQSNGMTACCLADYDSEEEFNVFLYRFRTDLLEGFRHATMVAPLVTFTYVQQWLTAKIT
KGMGNLRYKSDQNDREYLEWEALAQALDSVVSRILLINERPSVQTGLQLLELCLGYSPQD
PCLLSALLSCISALFVFLSMSTGSMAMPGIAVLPRVLEKIFAALVFEAPGESKGNRSKAA
KSVRRHAASLMVKISLKYPLLLLPVFEQIRTMVRGLAREPSPLSKMESIMLYEALLLISN
HFCDYERQTRFVAEVIGEGSGKFVALGAEWFKGPLELMRFVGLDRPPVESMLEDPAGRNR
TDLMICVCTVLSVVKRCSIPEDPDRAARGGFVAALSESGNPVYRNPVAPHVIPVLPTLFA
LLRTMNALFGPAALAALSEGYKNAYGLLESEKAHLLGLNVANDNTSETDQSSNTPLVRMQ
SFLSTIHDQCYHMLGSGCHMIGRDFYQLPGLAPALLNSVFSNMEAIPDYRLRPIIRVFMK
PFIYSCPPAFYESVLVPVLAHVSTHMCQRLSAKWQYIAHLYESGGLDEENTDTQEVIDDM
LNRNLTRDFVDVLKVALVGGAASDAAPPDTMEQDSGGMAVDPPLSRGNSIVAEVVSELGA
FVLRHPSTCHSVVLCVLGALAWNDSNASLKATMLTGPVVRALAADGSLTPSMASHIMVAV
LQGLQLHGQHEANQGSLVTLGAQVYECLRPKFPNIIEVMQQIPGVNPADLQRFDEKMSVV
STKGNKVEKGKKDLFKKITNQLIGRSVGQLFRKEVKIDNLPRIELLGFGKSPPVRVDEIS
ENAADTGITALFAGST
NT seq 3651 nt NT seq  +upstreamnt  +downstreamnt
atggagttcggagcaggcgatgtcgcccagatatcggcggagctcgcaggtgtggtcgaa
gtgatgatgtcgcctgacgtacctcaagaacagcgtttggaagtatacaatgcctgcgaa
agattcaaagaatcctcgcccctgtgcgctcaatgcggtctgtatctggcgcaaaagtct
cccaacagaagctcggtggtccgccattttgggttgcagctgatggagcattgtgtgaag
taccggtggacgcagatctcacagtcggagaagatcttcatcaaggagaacgcgatgaaa
ctgcttcaggagggtactgagccgctgttacaggaggaagcgcacataaaggacgccctg
tcgcgtgtagtagtggagatgataaaacgggagtggcctcagcagtggccgacgctactg
gccgagctctgtcaagcttgcacgcgcggagaaagccagaccgaactggttctgttggtg
ttccttagactagtggaggatgtggcgcttctgcagacgctcgagtccaaccagaggagg
aaagacatataccaggcgttaaccacaaacatggcggagatctttagcttctttttgaga
ctgatggagcaacatttttccgagtttcagaagaaaagtgccttaggacaaatgtccgat
gccgcggcacacagtaaagtcgtgcaggtagtactgtccacgctaactggattcgtcgag
tgggtctccataaatcacgtgatggccgaagacggcaggctgttgcagatactgtgcctg
ctgctgggcaatcccatatttcagtgttccgccgccgagtgtctgctgcaaatcgtgaac
cgtaagggcaaagccgaggatcggaagcaactgatgatcctcttctcggaggaagctctt
aggtgtatttacacggcagctaccagtccaccgcctctcaccggacctacaacgaacgag
aatcattatctgttcctgaagaaactcacacaggtactgaccggcatggcgacgcaactg
tgcaccttatgggggaaggacgacgcctctagcatacggccgacgcacttcaatatcttc
ctggacaccgttctcaccttcaccatgtactcgagcctcacgctcacgcatttagcgaac
gcgatctgggtgatgctgttcaaacacgagcagattaagactgactcgctgctgctgacg
tacgtgccgaagtacgtggagaacaccgcgcccaagctgatcaaagtggcgtatccgcac
agcagacagagcaacgggatgaccgcttgctgcctcgccgattacgactcggaggaggag
ttcaacgtcttcctctaccgcttcaggaccgatctgctcgagggcttcaggcacgcgacc
atggtggcgccgttggtcaccttcacgtacgtgcaacagtggttaaccgcgaagataacc
aagggtatggggaacctgcggtacaagagcgaccagaacgatcgcgagtacctcgagtgg
gaagccctcgcccaagccttggactcggtcgtctcgaggatcttgctgatcaacgagagg
ccgagcgtgcagaccggcctgcagctgttggagctctgtctcggctactcgccgcaggac
ccctgcctcctgtccgccctcttgtcttgcataagcgccctcttcgtcttcctgtcgatg
tcgaccggctcgatggccatgccgggtatcgccgtactgccgcgcgtcctcgagaagatc
ttcgccgctctcgtgttcgaggcgcccggcgagagcaagggcaatcgctcgaaggcggcc
aagagcgtccggcgtcacgcggccagtctcatggtgaagatcagcctgaagtatccgttg
ctgctgctgccggtcttcgagcagatacgcacgatggtgcgcggcctcgccagggagccc
agcccgttgtccaagatggagagcatcatgctttacgaggcgctgctgctgatctcgaat
cacttctgcgactacgagaggcagactcgcttcgtggcggaggttatcggcgagggctcc
ggcaaattcgtcgcactcggcgccgagtggttcaagggcccgttggagctgatgcgattc
gtcggcctggaccgaccgcctgtcgagagcatgctggaggacccggctggccgcaatcgc
accgacctcatgatctgcgtctgcaccgtgctgagcgtcgtcaagaggtgttccattccg
gaggaccccgaccgcgccgccaggggcggcttcgtcgccgcgctcagcgagagcggcaat
ccggtctacagaaatccggtcgcgccccacgtgatcccggtgctgccgacgctcttcgcg
ctgctccgcacgatgaacgctctcttcggccccgccgctttggccgctttgtccgagggc
tacaagaatgcctatggactcctggagtcggagaaggcgcatctattgggtctgaacgtg
gctaacgacaacactagtgaaacggatcaatcctcgaacactcccttggtccgaatgcaa
tcattcctcagcacgattcacgatcagtgctatcacatgttaggtagcggctgtcacatg
atcggccgagacttttatcaattacctggactcgcaccggcattgttgaactcggtcttc
tcgaatatggaggctattccggactacagactacggccgatcatacgcgtgttcatgaag
ccgttcatatactcttgcccgccggctttctacgagagcgtactagtacctgtactggcc
cacgtatccacacacatgtgccaaagattaagcgcaaaatggcaatacatcgcgcacctc
tacgagtccggcggcctcgacgaggagaacaccgacacgcaggaggtgatcgacgacatg
ctcaatcggaatctgaccagggacttcgtggacgtgctaaaggtggctctggtcggtggt
gctgcgagtgacgccgcccctccggacactatggagcaggacagtgggggaatggcggtg
gaccctccgctttcgcggggcaacagtatcgtcgccgaggtcgtcagcgaactgggagcc
ttcgtcttgcgccacccgtccacgtgccacagcgttgtcctatgcgtactgggtgcgctc
gcgtggaatgactcgaacgcgagtctcaaggccacaatgttgaccggccccgtcgttcgt
gcactggcggccgacggtagtctcactccctctatggcgtcgcacatcatggtggcggtt
ctccagggtctgcagctgcacggccaacacgaagccaatcagggctcgctcgtcacactg
ggcgcccaagtgtacgagtgcctccggcccaagttcccgaacatcatcgaggtgatgcag
cagatcccgggtgtcaatcccgccgatctgcaacgtttcgacgagaagatgtcggtggtc
agtacgaagggcaacaaggtcgagaagggcaagaaggatctctttaagaaaattacaaat
cagcttatcggccgaagcgtaggtcagttgttccgcaaagaagtcaaaatagacaattta
ccgcgaatcgaattgctcgggttcggcaagtctccgccagtacgcgtggatgagatctcg
gagaacgcagctgatacggggataacagctctattcgctgggtctacgtag

DBGET integrated database retrieval system