KEGG   Dinoponera quadriceps: 106747677Help
Entry
106747677         CDS       T05610                                 

Definition
(RefSeq) N6-adenosine-methyltransferase subunit METTL3
  KO
K05925  mRNA m6A methyltransferase [EC:2.1.1.348]
Organism
dqu  Dinoponera quadriceps
Brite
KEGG Orthology (KO) [BR:dqu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dqu03019]
    106747677
Enzymes [BR:dqu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.348  mRNA m6A methyltransferase
     106747677
Messenger RNA biogenesis [BR:dqu03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    N6-methyltransferase complex
     106747677
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MT-A70 PadR TrmB
Motif
Other DBs
NCBI-GeneID: 106747677
NCBI-ProteinID: XP_014480930
Position
Unknown
AA seq 548 aa AA seqDB search
MSDAFEEIQAIKIKRNSLREKLQKRKRERHELFTLTSTPVPPILRTESVDPDSNTSSLRS
DHSEYERDILCILHESLPSLPITSADLIDQLRKNLNADVSSSDIYKILEKLAAQDIVKIK
EVTENGVFGYTVLSFTESQSSYQSQSDDTENAESTETSSELYDYILPEKQAKMEKKNTED
IMSLISMPTIREKESKKVGEQILDLLSKQTSKEKSLAERFRSQGGAQVMEFCPHGTRVDC
VKLNGGPGFAEKCKKLHFKKIIQSHTDESLGDCSFLNTCFHMDTCKYVHYEVDGPTAQPK
ETNDFDNPSNTTTNKTLSLDGKNGGGTSGNAGSELTLYPPQWIQCDLRYLDMTVLGKFAV
IMADPPWDIHMELPYGTMSDDEMRQLGIPALQDEGLLFLWVTGRAMELGRECLQLWGYER
VDEIIWVKTNQLQRIIRTGRTGHWLNHGKEHCLVGMKGNPRINRGLDSDVIVAEVRATSH
KPDEIYGIIERMSPGTRKIELFGRPHNVQPNWITLGNQVDGVHLIDPQLIKAFKKRYPDG
NAMKPTKP
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatgcttttgaggagatacaagcgatcaagataaagaggaacagccttcgtgag
aagctgcagaaaaggaagcgggaaagacatgagttgttcactcttacttccactccagta
ccacccatcctcaggacagaatcagtggatcctgattctaacacatcgtcattgcgttct
gaccatagcgaatacgaaagagacatactttgtatcttgcacgagtccctgcctagtttg
ccaataacatccgcggacctgatagatcaactgcgcaaaaatttaaatgcagacgtgtcc
tcctctgacatttataagattctggagaaactggctgcccaagatatagttaaaatcaag
gaagtcacggagaatggagtgttcggctacacagtgctatccttcacagagtctcagtcg
tcttatcagtctcagtctgacgacacggagaacgccgagagcacagagacctcttccgaa
ttgtacgactacatattgccggagaaacaggcgaaaatggagaagaagaataccgaggat
atcatgtccttgatctcgatgccgacgatccgagagaaggagagcaagaaagtcggcgaa
caaattctggacctgttgtccaaacagacctccaaggagaagtcgctggcggaacggttt
cgctcccagggcggcgcccaagtcatggagttctgcccgcatggcacgcgggtggactgt
gtgaagctgaacggcggcccgggattcgcggagaagtgtaagaaactgcacttcaagaag
atcatacagagccatacggacgaatcattgggcgactgcagtttcctcaatacctgcttc
cacatggacacgtgcaaatacgttcattacgaggtggacggtcctacagcgcagccgaag
gagaccaacgatttcgacaaccccagcaataccacgactaacaagacactaagcctggac
ggtaagaacggcggtggcaccagcggtaacgcaggcagcgagctcacattgtacccaccg
caatggattcaatgtgacctacgttatctggacatgactgtgctcggcaagttcgccgtg
atcatggccgacccgccgtgggatatccacatggaattaccttacggcaccatgtcggac
gacgagatgaggcagttggggatcccggcgcttcaggacgagggacttctgttcctgtgg
gtaaccggcagggccatggagcttggcagagagtgtctgcaactgtggggctacgaaagg
gtcgacgagatcatctgggtgaagaccaatcagctgcaaaggataatacgtacgggcagg
actggccattggctgaatcacggcaaggagcactgcctggtcggcatgaagggcaatcct
cgcatcaaccgaggtctggacagcgacgtgatcgttgccgaggtgcgcgccaccagccat
aaaccagacgagatctatggcatcatcgagcgcatgagtcccggcaccaggaagatcgag
ctgttcggtcggccgcacaacgtccaacccaactggatcaccctgggcaatcaggtggac
ggtgtccatctgatcgacccgcagctcatcaaagccttcaagaaacggtatccagatggg
aacgccatgaaacctactaagccgtaa

DBGET integrated database retrieval system