KEGG   Dinoponera quadriceps: 106749181Help
Entry
106749181         CDS       T05610                                 

Definition
(RefSeq) activin receptor type-1-like isoform X1
  KO
K04675  activin receptor type-1 [EC:2.7.11.30]
Organism
dqu  Dinoponera quadriceps
Pathway
dqu04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:dqu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    106749181
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dqu01001]
    106749181
Enzymes [BR:dqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     106749181
Protein kinases [BR:dqu01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   106749181
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase TGF_beta_GS Activin_recp UPAR_LY6 Pkinase_fungal DUF2534 BAMBI Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 106749181
NCBI-ProteinID: XP_014483845
Position
Unknown
AA seq 587 aa AA seqDB search
MADVIFITYFVLLLTFRLCTVYIGFPGEGDIIALQEHDTSFDEEPNLSEPLDHNFGSSTV
GQKRLKCHICDDAECLPPRICENAITCWKSRVREEDGTEYVSRGCYTTEDHKKFMCNREE
NVEHAEERIRNLRGGVQYSVECCQEDFCNVGPYPVLHDYSNNSNREYYVLKLTFAILGSV
AGLFIAGGFLLCLLTHQLRRKESMAPHQNELMIDSDIEPSMLHFSFPSSTPSASYHPHEL
RATAAGDSTLKEYLDGRSLTSGSGSGLPLLVQRTLAKQVALVECLSNGNSSFGGEVWRGV
WHGESVAVKIYFSRDEAAWARETEVYSELLPSRHDNILGYVGSDMTSRGSCTQLWLVTHY
HPLGSLFDHLNRSPHPLTHHQTLNICVGIANGLLYLHTEIHGTRGKPAMAHRNLKSKNIL
VKTNGGCVIADFALATTQDRLSAERVDLRQGTKRYMSPEILEQTMNVECLESFRRADVYS
LGLILWEVCLRCISNGVVLEYAMPYSEWLSSSNQEPSVEEMRKLVVFDQRRPPLPNRWHS
DPTLAGMGKLMRECWHGKPAARLPILRVKKTLVKLAASDSRVHLPLD
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atggcggatgttatatttatcacgtatttcgtactcttgttgacattcagattatgtaca
gtttacattggttttccaggcgaaggagatattattgcattacaggaacatgatacttcc
tttgacgaggaaccaaatttgtctgaaccattagatcataattttggcagcagtacagtt
ggccaaaagcgtcttaagtgccatatatgtgatgatgccgaatgtttgccacctcgcatc
tgtgaaaatgcaatcacttgttggaaatctagggtaagagaggaagatggcacagaatat
gttagccgtggttgttatacaactgaagatcataagaagtttatgtgtaacagagaagaa
aatgtcgaacatgcagaggaacgtattagaaacctacgaggtggtgttcaatactctgta
gaatgttgccaagaagacttttgtaatgttggaccatatcctgtattgcacgattattca
aacaattccaacagagaatattacgtactgaaattaacgttcgcaatacttggatctgtg
gctggattattcatcgctggagggttcctcttatgcctattgacgcaccagttgcgaagg
aaagagtcaatggcgccgcatcaaaacgagctgatgatagattccgacatcgagccttcc
atgttacatttctcgtttccttcctcaacaccatccgcttcttatcatccgcacgagctt
agagcaactgccgccggtgatagtacgcttaaagagtacttagatggtcgaagtctaacc
agtggctccggttctggattgcctttgttggtgcagagaaccttagccaagcaagtagct
ctggtagagtgtctcagtaatggtaacagcagtttcggtggggaagtatggcgaggtgtc
tggcatggcgagagtgtcgctgtgaagatctatttttcacgggatgaagctgcctgggca
cgagaaaccgaggtttattcagaacttttgccgtccagacacgacaatatcctaggatac
gttggtagtgatatgaccagcaggggcagttgcactcaactatggctggtgacgcattat
catccgctcggctcgctcttcgatcatctcaatcgatcgccgcatccgttaacgcatcat
cagacgctcaatatctgcgttggtatcgctaacggtttgctttatctgcatacggagatt
catggtaccagaggtaagccagccatggcccaccgtaacctcaagtcgaaaaatatcctg
gttaaaaccaacggtggctgcgtgatcgccgatttcgcattagcgaccacgcaggatcgc
ctctcggcggaaagagtcgacttgcggcaaggaacgaagcgttacatgagccctgagatt
cttgaacaaacgatgaacgtcgaatgtttagagagtttcagacgagcagacgtctatagt
ttaggactgatattgtgggaggtttgtctcagatgtataagtaacggcgtagttttggag
tacgcgatgccgtacagcgaatggttatcaagcagtaatcaagagccctccgtagaagaa
atgcgtaaattagtcgtgttcgatcagcgaaggccacctcttccgaataggtggcattct
gacccgacattggctgggatgggaaaattaatgcgggagtgttggcatggcaaaccagca
gccaggctacccattctcagggtaaagaagacactcgttaaattagcagctagtgattct
cgtgttcatttacctctcgactga

DBGET integrated database retrieval system