KEGG   Dinoponera quadriceps: 106751823Help
Entry
106751823         CDS       T05610                                 

Definition
(RefSeq) dipeptidyl peptidase 3
  KO
K01277  dipeptidyl-peptidase III [EC:3.4.14.4]
Organism
dqu  Dinoponera quadriceps
Brite
KEGG Orthology (KO) [BR:dqu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dqu01002]
    106751823
Enzymes [BR:dqu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.4  dipeptidyl-peptidase III
     106751823
Peptidases and inhibitors [BR:dqu01002]
 Metallo peptidases
  Family M49: dipeptidyl-peptidase III family
   106751823
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M49
Motif
Other DBs
NCBI-GeneID: 106751823
NCBI-ProteinID: XP_014488498
Position
Unknown
AA seq 727 aa AA seqDB search
MNVDTTLYTLPNNQPIVALQCENVFKALTQKEKLYAHYLSQAAWSGGLIVLIQTSPESPL
IFALLHKIYLTEPINELKDAVIHANVTEDEFTAFLVYSCGIFGNAGNYKAMGDTKIIPNL
SKDAFEIIIKTSKAYKNNPTEIQNIWNDISEVLYSLDGKLKSLGMGDKGITTYFSANCTK
EDADKVNAFMQHKGLESYNARCFKTTVCDHASNNNVDMYEIRLASVETSDDPNITLFEEI
YENTRFKITRGDYDQLMVFVVENLTKAKEYASNQIEENMLEKYIDHFKTGSLDNHKDGSR
LWIKDKGPAIETYIGFIETYRDPAGQRGEFEGFVAMVNKEMSAKFAMLVNKAEELIPRLP
WSSDFEKDSYLRPDFTSLDVLTFAGSCIPSGINIPNYDEIRQSEGFKNVSLGNVIPAHMK
DPIPFLSEDDQALMHKYRIDSFEVQVGLHELLGHGTGKYFRQTGPDTYNFDRNKVTNPLN
GDRIDIFFQKGETYDSKFGTMGSSYEECRAEAVGLYLSLEKDVLEIFGHQESTADDIIYV
NWLSLLWGGFAKAFEMYQPDTKTWSQAHAQARYVLLRVCLEAGDNFVNVVETENGKNLRM
TVDRTKIFTVGKTAIGNFLVKLHVYKSMGDVESARELYDRYSEVPENGTYPWARWRDIIL
SRKEPRKIFVQPNTFIDDLNHVILKNYESSHTGLIQSWVERFPNLNASQILIELWNRDKH
HFISTNN
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgaacgttgatactacgttgtacacattaccaaacaatcagcctattgttgcattacaa
tgtgaaaatgtgtttaaagctttaacgcaaaaggagaaactatatgctcattatttgagc
caggctgcatggagcggaggattgatagtattaatacagacatcaccggaatcgccattg
atatttgcattattacataaaatttatcttacggaaccaatcaacgaattaaaagatgct
gtaatacacgctaatgtcaccgaagatgagtttactgctttcttagtctatagttgtgga
atatttggaaacgcaggaaattacaaagctatgggtgatactaaaattattccaaacctt
tcgaaagatgcatttgaaataataataaagacttcaaaagcttataagaataatccgaca
gagatacaaaacatatggaacgatatatcagaagtcctttattcgttagatggaaaactg
aaatcattgggaatgggtgataaaggaattacaacgtatttttctgcaaactgtactaag
gaggatgcagataaggtgaatgcatttatgcaacataaaggattggaatcttataatgcc
agatgtttcaaaacaactgtatgtgatcatgcgagtaataataacgtcgatatgtatgaa
atacgattggcgtctgtagaaacttcagatgatcctaatattactttattcgaggaaata
tacgagaataccagatttaagattacaagaggtgattacgatcaacttatggtattcgtt
gttgaaaatctaacaaaagccaaggaatacgcgtctaatcagattgaggaaaacatgttg
gagaaatatattgatcattttaaaactggatctttagacaaccataaagatggttctcgc
ctttggataaaagataaaggacctgctatcgaaacttacatcggttttattgaaacgtat
agagacccagcgggtcagaggggtgagttcgaaggtttcgtggcgatggtaaataaggaa
atgtcggcaaaatttgctatgttggtcaacaaagctgaggaattgattcccagacttcca
tggagcagtgatttcgagaaagattcatatcttagaccggacttcacctctttggatgtt
ctgacgttcgctggttcttgcattccatcgggaataaatattccgaattatgacgagatt
agacagtccgagggttttaaaaacgtgtctctaggaaatgttatacctgcgcatatgaaa
gacccgataccgtttctttcggaagacgatcaggcgttgatgcataaatacaggatagac
agttttgaagtgcaagttggtttgcatgaactgctcggtcacggtactggtaaatacttt
aggcaaacgggaccagatacctacaacttcgaccgcaacaaagtgacaaaccctttaaat
ggcgataggatagatatatttttccaaaaaggagaaacttacgattcaaaatttggcact
atggggtcttcgtatgaagaatgcagggccgaagcggttggtctttacttgagcttagag
aaggacgtgttggaaatatttggtcaccaggaatcaacggcagacgatataatttatgtg
aattggttgtctctgttatggggtggtttcgcgaaggctttcgaaatgtatcaacctgat
acgaagacatggtcgcaggctcatgctcaagcgcgctacgttttacttcgagtttgtctg
gaggcgggtgacaattttgttaacgtcgttgagactgaaaacgggaagaacctccgaatg
actgtcgatcgaacgaaaatttttacggttggtaaaacggctattgggaacttccttgtg
aaattacatgtctataaaagtatgggagacgtcgagtcagccagggaactgtatgatagg
tacagtgaagtgcctgaaaacgggacttatccctgggcccgttggagagacatcatcttg
tcacgtaaagaaccaaggaagatatttgttcaaccaaatacatttattgacgatttgaat
catgtgatactaaagaattacgaatcgtcgcatacaggacttattcaatcgtgggtagag
agatttcccaatttaaatgcatctcaaatactgatagaactttggaacagagataaacac
cattttatatcgacgaataattga

DBGET integrated database retrieval system