KEGG   Dinoponera quadriceps: 106752386Help
Entry
106752386         CDS       T05610                                 

Definition
(RefSeq) vacuolar protein sorting-associated protein 41 homolog isoform X1
  KO
K20184  vacuolar protein sorting-associated protein 41
Organism
dqu  Dinoponera quadriceps
Brite
KEGG Orthology (KO) [BR:dqu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dqu04131]
    106752386
Membrane trafficking [BR:dqu04131]
 Endosome - Lysosome transport
  Tethering complex
   Hops complex
    106752386
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin Vps39_2 WD40 zf-RING_5 Vps39_1 ANAPC4_WD40 TPR_7 zf-RING_2 TPR_2 zf-RING_UBOX zf-C3HC4_2
Motif
Other DBs
NCBI-GeneID: 106752386
NCBI-ProteinID: XP_014489544
Position
Unknown
AA seq 846 aa AA seqDB search
METTLNKDEQNNQDDSDSSEIDEVEPRLKYVRIRNDLEHILQNDAASCIAVHPKFLCLGS
HWGMIHLLDHQGNNVKSKTLQAHTVAVNQISIDHNGDFIASCSDDGKVFIYGLYSTENNH
NMSMGRLVKSIAIDPNYYKSGSGRRFITGDDKLVLYEKTFLARMKSIVLCEAEGGVRSVA
WSSRFVAWASDTGVRVYDLDARCSLGLIKWSRTADASPEHYRCNLQWSDDKTLLIGWVDV
VRVCQIRKRTMQEMVNRDLPEFVVDPVSTFQVDFYISGIAPLGNQLVLLGCLKTLDENGK
SQRPTLHVVEPNGQDFSVICANSLTLRGYKEYSCNDYHLDCLKEENRFFIVSPKDIVVAS
LYDADDRIDWLLNHGKFEQALEAVTANGKDCKKHTLLYVGRTYLDHLLKYQRYDEAGKLC
LKILGRNKKLWEEEVYKFARVHQLRSISSYLPRGDVTLDPLIYEMVLYEYLKMDPDGFLQ
LVKEWSPSLYTVAAVVNGVLEHLLVHNQRQNVLLEALAILYIYDGKYDKALAMYLKLRHK
DVFQLIQKYQLYSSVYEMIEGLMDLDTDRAIQFFLEKDRVPSEVVVQKLQHNQRYLYLYL
DALDKKDTKDSKGKYHDLLIRLYADYSRDKLLPLLRRSDSYPIQQALDICSQRQFYPEMV
YLLGRMGNTSEALALMTRELNDMESAIAFCQEHDDKELWNDLVNYSLDKPAAITFLLQRI
GTYVDPRLMVQRIEPTLEIPGLKKALVKMMCDYNLQVSVQEGCKKILSNDYFNLHERLVR
CHQKGIFIDDDQMCGACHRKIIVRDPRNMVVFYCKHSFHEDCLPNFELVENCVICNSQKE
MVPSRK
NT seq 2541 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaacgttgaataaagacgagcagaataatcaagatgactcggattcttcagaa
atagatgaagtagaaccaagacttaagtatgtgaggattcgcaatgatctggaacatata
ctacagaatgacgcagccagctgtatagctgtacatccaaagttcctctgtctaggatca
cattggggaatgatccatcttctggaccaccaggggaacaatgtaaagtctaaaacatta
caggcacacacagtggcagtcaatcagatttctatagaccataatggtgacttcattgct
tcttgtagtgatgatggaaaagttttcatctatggactatatagtacagagaacaatcat
aatatgagtatgggcaggctggtgaaaagtatagcaattgatccaaattattacaaaagt
ggcagtggcagaagatttattacaggtgatgacaaactggtgctctacgagaagactttc
ctagccaggatgaagtcaatagtgctttgtgaggcagagggtggagtcaggtctgttgct
tggtccagtcgcttcgtggcctgggcatctgatactggtgtgagagtttacgacctcgat
gccaggtgttcactgggactgatcaagtggtctcgtacagcagacgcatcgccagaacat
tatagatgtaatctgcagtggtcggatgataaaacactgttaattgggtgggtggacgtc
gtccgggtctgtcagatcagaaagcgtactatgcaagaaatggtaaatcgagacttgccc
gaatttgtagtggatccagtatcgacattccaagtagatttttacatatccggtatagcg
ccattgggaaatcagctagtattgctgggatgcctaaaaacgctggacgaaaatggaaaa
agtcaacgtccgaccctgcatgtggttgaacccaatggtcaggatttctcggtaatatgc
gcaaactcgctcacactacgaggctacaaggagtacagttgcaacgattaccacctggac
tgtttaaaagaagaaaacagatttttcatcgtcagtccaaaagacattgtagtagccagt
ttatacgatgcagacgataggatcgattggctgttgaaccacgggaaattcgagcaagct
ctggaagcggtaacagcaaacggcaaagattgcaaaaagcacacattgttgtacgtaggc
cgtacttatttggatcatttgttaaagtatcaaaggtatgacgaggctgggaaactttgc
ctcaagattttaggacgaaataaaaaattgtgggaggaagaggtttacaagttcgccaga
gtgcatcaattacgttctatctcgtcttatttgcctcgaggtgatgtcaccctcgatccg
ttgatctacgagatggtactgtacgagtacctgaagatggatcccgacggtttcctgcag
ctagtcaaagaatggtctccaagcttatatacagtggcagcggtagttaacggcgtgttg
gagcatttactagtccacaatcagcgacagaacgtactgttggaagcattagcgattctg
tatatctacgacggcaaatacgacaaagcgctcgccatgtacttgaagttgcgacataaa
gacgtcttccaattgatccagaagtatcagttgtacagttcggtatacgaaatgatcgaa
ggtctgatggatctggacacggatcgtgccatacagttctttttggagaaggacagggtg
ccgtctgaagttgttgtgcagaagctgcagcataatcaacgttacttatacctgtatttg
gatgccttagacaaaaaagatacgaaagactcgaaaggcaagtatcatgacttgctgata
cgactgtacgctgattattcgagggacaagctgttgccgcttctacgtcgttccgatagt
tatccgatacagcaagccttggatatatgtagtcagcgtcaattttatcccgaaatggtg
tacctgttgggcagaatgggaaacacttcggaagccttggcgctcatgacgagggaactc
aacgatatggagagtgctattgcgttttgccaagaacacgacgataaggaactgtggaac
gacttagttaattattcgctcgacaaacctgcggctattacgttccttctccaaaggatc
ggtacctacgtcgatcctcggctcatggtacagaggatagagcccactttggagatcccc
ggactgaagaaggcgctagtcaagatgatgtgtgactataatctgcaggtgtccgtgcag
gaaggttgtaagaagatcttgtccaatgattatttcaaccttcatgagaggctcgttcgt
tgtcaccagaaaggcatatttatcgacgacgaccaaatgtgcggagcttgccataggaag
ataattgtaagagatccgcggaacatggttgtattttattgtaagcactctttccacgag
gattgtctacccaactttgaattggttgaaaattgtgtaatctgcaattcgcaaaaggaa
atggtgcctagcagaaaatga

DBGET integrated database retrieval system