KEGG   Deinococcus radiodurans: DR_0311Help
Entry
DR_0311           CDS       T00025                                 

Gene name
rplC
Definition
(RefSeq) 50S ribosomal protein L3
  KO
K02906  large subunit ribosomal protein L3
Organism
dra  Deinococcus radiodurans
Pathway
dra03010  Ribosome
Module
dra_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:dra00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    DR_0311 (rplC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:dra03011]
    DR_0311 (rplC)
Ribosome [BR:dra03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    DR_0311 (rplC)
  Bacteria
    DR_0311 (rplC)
  Archaea
    DR_0311 (rplC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L3
Motif
Other DBs
NCBI-GeneID: 1799285
NCBI-ProteinID: NP_294034
UniProt: Q9RXK2
Structure
PDB: 

Position
1:312685..313320
Genome map
AA seq 211 aa AA seqDB search
MKGILGTKIGMTQIWKNDRAIPVTVVLAGPCPIVQRKTAQTDGYEAVQIGYAPKAERKVN
KPMQGHFAKAGVAPTRILREFRGFAPDGDSVNVDIFAEGEKIDATGTSKGKGTQGVMKRW
NFAGGPASHGSKKWHRRPGSIGQRKTPGRVYKGKRMAGHMGMERVTVQNLEVVEIRAGEN
LILVKGAIPGANGGLVVLRSAAKASAAKGGK
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaagggcatcctcggcaccaagatcggcatgacccagatctggaaaaacgaccgtgcg
atccccgtgacggtcgtgctggcgggcccttgccccatcgtgcagcgcaagaccgcgcag
accgacggctacgaagccgtgcagatcggttacgcgcccaaggccgagcgcaaggtgaac
aagcccatgcagggtcacttcgccaaggcgggcgtcgctccgacgcgcattctgcgcgag
ttccgcggcttcgcccctgacggcgacagcgtgaacgtggacatcttcgctgaaggcgaa
aagatcgacgcgaccggcaccagcaagggcaaaggcacccagggcgtcatgaagcgctgg
aactttgccggtggtcccgcaagccacggttcgaagaagtggcaccgccgccccggttcg
atcggtcagcgtaagaccccgggccgcgtgtacaagggcaagcgcatggccggccacatg
ggcatggagcgcgtgaccgtgcagaacctcgaagtggtggaaatccgtgcgggcgagaac
ctgattctcgttaagggcgcgattcccggcgccaacggcggactcgtggtgctgcgcagc
gccgccaaagccagtgccgccaagggaggcaagtaa

DBGET integrated database retrieval system