KEGG   Deinococcus radiodurans: DR_0318
Entry
DR_0318           CDS       T00025                                 

Gene name
rplP
Definition
(RefSeq) 50S ribosomal protein L16
  KO
K02878  large subunit ribosomal protein L16
Organism
dra  Deinococcus radiodurans
Pathway
dra03010  Ribosome
Brite
KEGG Orthology (KO) [BR:dra00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    DR_0318 (rplP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:dra03011]
    DR_0318 (rplP)
Ribosome [BR:dra03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    DR_0318 (rplP)
  Bacteria
    DR_0318 (rplP)
SSDB
Motif
Pfam: Ribosomal_L16
Other DBs
NCBI-GeneID: 1798664
NCBI-ProteinID: NP_294041
UniProt: Q9RXJ5
Structure
PDB: 

Position
1:316508..316936
AA seq 142 aa
MMLLPKRTKFRKQFRGRMTGDAKGGDYVAFGDYGLIAMEPAWIKSNQIEACRIVMSRHFR
RGGKIYIRIFPDKPVTKKPAETRMGKGKGAVEYWVSVVKPGRVMFEVAGVTEEQAKEAFR
LAGHKLPIQTKMVKREVYDEAQ
NT seq 429 nt   +upstreamnt  +downstreamnt
atgatgcttctcccgaagcgcaccaagttccgtaagcagttccgtggccgcatgaccggc
gacgccaagggtggcgattacgtggccttcggcgactatggcctgatcgccatggagccc
gcctggatcaagagcaaccagatcgaggcctgccgtatcgtcatgagccgtcacttccgc
cgtggcggtaagatctacatccgcatcttccccgacaagcccgtgaccaagaagcccgcc
gaaacccgaatggggaaggggaagggcgctgtggagtactgggtcagcgtcgtgaagcct
ggccgcgtgatgttcgaggtggcgggcgtgaccgaagagcaggccaaggaagccttccgc
ctggccggtcacaagctccccatccagaccaagatggtgaagcgcgaggtttacgatgaa
gcccagtga

DBGET integrated database retrieval system