KEGG   Deinococcus radiodurans: DR_0321
Entry
DR_0321           CDS       T00025                                 

Gene name
rplN
Definition
(RefSeq) 50S ribosomal protein L14
  KO
K02874  large subunit ribosomal protein L14
Organism
dra  Deinococcus radiodurans
Pathway
dra03010  Ribosome
Brite
KEGG Orthology (KO) [BR:dra00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    DR_0321 (rplN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:dra03011]
    DR_0321 (rplN)
Ribosome [BR:dra03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    DR_0321 (rplN)
  Bacteria
    DR_0321 (rplN)
  Archaea
    DR_0321 (rplN)
SSDB
Motif
Pfam: Ribosomal_L14
Other DBs
NCBI-GeneID: 1797713
NCBI-ProteinID: NP_294044
UniProt: Q9RXJ2
Structure
PDB: 

Position
1:317410..317814
AA seq 134 aa
MIMPQSRLDVADNSGAREIMCIRVLNSGIGGKGLTTGGGGNKRYAHVGDIIVASVKDAAP
RGAVKAGDVVKAVVVRTSHAIKRADGSTIRFDRNAAVIINNQGEPRGTRVFGPVARELRD
RRFMKIVSLAPEVL
NT seq 405 nt   +upstreamnt  +downstreamnt
atgatcatgcctcagtcccgcctggacgtggcggacaacagcggcgcgcgcgaaatcatg
tgcattcgcgtgctcaacagcggcatcggcggcaagggcctgaccaccggtgggggcggc
aacaagcgttacgcccacgtcggtgacatcatcgtcgcctcggtcaaggacgcggctccc
cgcggcgccgtgaaggccggcgacgtggtcaaggccgtggtcgtgcgcaccagccacgcc
atcaagcgtgccgacggcagcaccatccgctttgaccgcaacgccgccgtcatcatcaac
aaccagggcgagccccgcggcacccgcgtcttcgggccggtggcccgcgagctgcgtgac
cgccgcttcatgaagatcgtgtccctggctccggaggtgctgtaa

DBGET integrated database retrieval system