KEGG   Deinococcus radiodurans: DR_0819
Entry
DR_0819           CDS       T00025                                 

Definition
(RefSeq) hypothetical protein
Organism
dra  Deinococcus radiodurans
SSDB
Motif
Pfam: RecO_C RecO_N ArfGap RecO_N_2
Other DBs
NCBI-GeneID: 1799732
NCBI-ProteinID: NP_294543
UniProt: Q9RW50
Structure
PDB: 
1U5K 4JCV 2V1C 1W3S

Position
1:832077..832811
AA seq 244 aa
MRSRTANRSGIVIRRRVTPAGDIIVTLLTPQGKLKAIARGGVKGPLSSSLNLFHHVGVQV
YQGPHNDLASVKQAVLEGALPTLAEPERYAFAHLMAEFADALFQEGEFSEQAFDLFAASL
RGVAHQPDPEWVALVMSYKLLGLAGVIPQTARCARCGAPDPEHPDPLGGQLLCSKCAALP
PYPPAVLDFLRHAVRRTVRASFEQPVPSADRPALWRALEKFVTVQVGGVHSWRQLVPSGV
PVLS
NT seq 735 nt   +upstreamnt  +downstreamnt
atgcgctcacgcaccgccaaccgcagcggcatcgtcatccgccgccgggtgacgcctgcc
ggcgacatcatcgtcacgctgctgaccccccagggcaagctcaaggccatcgcgcgtggc
ggggtcaaggggccgctgtcgagcagcctcaacctctttcaccatgttggggtgcaggtg
taccaggggccgcacaacgaccttgccagcgtgaaacaggcggtgctggagggcgccctg
cccaccctggccgagcctgagcgctacgccttcgcgcacctgatggccgaatttgccgac
gcgctgtttcaggaaggcgagttctccgagcaggccttcgacctcttcgccgcctcgctg
cgcggcgtggcgcaccagcccgaccccgagtgggtggcgctcgtcatgagctacaagctg
ctcggactggccggggtgatcccccagaccgctcgctgcgcccgttgcggcgcgcccgac
cctgagcaccccgaccccctcggcggacaactgctgtgcagcaagtgcgcggccctcccg
ccctacccgcccgccgtcctcgacttcctgcgccacgccgtgcggcgcaccgtccgcgcc
agctttgagcagccggtgccgagtgccgaccgccccgcgctgtggagagcgctggaaaag
ttcgtcacggtgcaggtcggcggcgtccacagctggcggcaactcgtcccaagcggcgtg
ccggtgctgagctag

DBGET integrated database retrieval system