KEGG   Deinococcus radiodurans: DR_0942Help
Entry
DR_0942           CDS       T00025                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
dra  Deinococcus radiodurans
Pathway
dra00260  Glycine, serine and threonine metabolism
dra00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dra01100  Metabolic pathways
dra01110  Biosynthesis of secondary metabolites
dra01130  Biosynthesis of antibiotics
dra01230  Biosynthesis of amino acids
Module
dra_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dra00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DR_0942 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DR_0942 (trpA)
Enzymes [BR:dra01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DR_0942 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB BtpA
Motif
Other DBs
NCBI-GeneID: 1798980
NCBI-ProteinID: NP_294666
UniProt: Q9RVT0
Position
1:957796..958608
Genome map
AA seq 270 aa AA seqDB search
MTATPETATNRGVQRLHAAFARAEAEGRAAFIPFMTGGYPDAARFGEVAGDLLARADIME
VGIPYSDPLGDGPTIQRASEQALAGGTSTRRTLELVRELRQKDDTPIVIMTYINPIYAVG
PAEFMRLAQEAGVDGLILPDLPPDQDLEIADLAAQHGLAVTFLIAPTSTPERVKLVAEAC
TGFLYAVSVTGVTGAREGAALGEVPRMLDLARQYAQRPVVVGFGVKDAATAQQVAQVADG
VVVGSAFINAVAAGRDVGALADELAAGCRR
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgactccagaaacggccaccaatcgtggggttcagcgcctgcacgccgctttt
gcgcgcgctgaggcggaaggccgcgccgccttcattcccttcatgaccggcggctacccc
gacgcggcccgcttcggtgaggtggccggcgacctgctcgcgcgcgccgacatcatggaa
gtggggattccctactctgacccgctcggcgacggccccaccattcagcgggcctcggaa
caggcgctcgcgggcggcaccagcacccggcgcacgctggaactggtgcgtgagctgcgg
cagaaggacgacacccccatcgtcatcatgacctacatcaacccgatctacgccgtcggt
cccgccgagttcatgcggctggcgcaggaggcgggggtggacgggctgattctccccgat
ctgccgcccgaccaggacctcgaaattgccgacctcgccgcgcagcacgggctggccgtc
accttcctgatcgcgccgacctccacccccgagcgcgtgaaactggtcgccgaggcctgc
actggcttcctctacgccgtcagcgtgaccggcgtgaccggcgcccgtgaaggcgcggcg
ctcggcgaggtgccccggatgctcgacctcgcccggcagtacgcgcagaggccggtggtc
gtcggcttcggtgtgaaggacgcggccaccgctcagcaggtcgcgcaggtcgccgacggc
gtggtggtcggcagcgcctttatcaacgcggtggcagcgggacgggatgtaggtgccctt
gccgacgagcttgccgccgggtgccgccgctag

DBGET integrated database retrieval system