KEGG   Deinococcus radiodurans: DR_0953Help
Entry
DR_0953           CDS       T00025                                 

Definition
(RefSeq) succinate dehydrogenase, hydrophobic subunit SdhD
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
dra  Deinococcus radiodurans
Pathway
dra00020  Citrate cycle (TCA cycle)
dra00190  Oxidative phosphorylation
dra00650  Butanoate metabolism
dra01100  Metabolic pathways
dra01110  Biosynthesis of secondary metabolites
dra01120  Microbial metabolism in diverse environments
dra01130  Biosynthesis of antibiotics
dra01200  Carbon metabolism
Module
dra_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dra_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dra_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:dra00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DR_0953
   00650 Butanoate metabolism
    DR_0953
  Energy metabolism
   00190 Oxidative phosphorylation
    DR_0953
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt Cyt_bd_oxida_II CybS VirB8
Motif
Other DBs
NCBI-GeneID: 1799567
NCBI-ProteinID: NP_294677
UniProt: Q9RVR9
Position
1:complement(966866..967243)
Genome map
AA seq 125 aa AA seqDB search
MIKARTLSDARQQSHSNAELNWWIFMRISGLILVFLVLGHIYMTFIQVSEADATYVAVVN
KLSNPAWKFYDWLILALALLHGANGARYSIEDYVRTRPDRAWIKGTFYTVIALLFAFGTV
GLFSL
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgattaaggcccgcacactcagcgacgcccggcagcagtcgcactccaacgccgagctg
aactggtggattttcatgcgcatcagcggcctgattctggtcttcctggtgctgggacac
atctacatgacctttatccaggtcagcgaggccgacgccacctacgtcgcggtcgtcaac
aagctcagcaaccccgcctggaagttctacgactggctgattctggccctcgccctgctg
cacggggccaacggcgcgcgctactccatcgaggactacgtgcggacccggcctgaccgt
gcctggatcaagggcaccttctacaccgtgatcgccctgctgtttgctttcggcacagtg
ggtctcttttccctctga

DBGET integrated database retrieval system