KEGG   Deinococcus radiodurans: DR_1130Help
Entry
DR_1130           CDS       T00025                                 

Definition
(RefSeq) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
dra  Deinococcus radiodurans
Pathway
dra00860  Porphyrin and chlorophyll metabolism
dra01100  Metabolic pathways
dra01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dra00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DR_1130
Enzymes [BR:dra01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     DR_1130
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     DR_1130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_binding_2 Pyr_redox_2 FAD_binding_3 GIDA HI0933_like Thi4 Pyr_redox_3 FAD_oxidored Lycopene_cycl Pyr_redox
Motif
Other DBs
NCBI-GeneID: 1798532
NCBI-ProteinID: NP_294854
UniProt: Q9RV99
Position
1:complement(1139263..1140651)
Genome map
AA seq 462 aa AA seqDB search
MSVRRLRWREGGPMTNPNAHTLPIIVVGAGMTGLAAAWELQQRGVPYVLLEAGDSFGGKV
QSERTEDEFLVEKAADAFILGKPWALQLAQEVGLQDELIHPRAETKKLYFLRGGELLDFP
QNLKMFVPLDDESFLQSGVLSPEGLRRMLDEQNVPPKENTDEDESLADFIIRRFGAEAMN
FIVPLAAGIYVANPFELSMKAAFPQFLALEQKYGSVIKGSRATPRAQGPIFGSFKDGMST
LANAVAAKLTGDVRLNTPVLAVHPDGVTLTGGEKIAASGVVLTAPAWVAAPTLGQSFPAA
SALVGELQTNGSVAVILAYREGQFPRDMHLHGLQVAADEGIEMKAITVHSAKLHGRAPEG
HVLLRVFFKDLDPQKALAEAVHEVARLFGAQGDPLWHAYADWRGKNPAYQVGHLDHIARI
RAALPPNIQVAGSSYTGVGIPDCVNAGRTAARDVVAALGVDG
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgtaaggcggctgaggtggcgtgagggggggccgatgaccaaccctaacgcccat
accctacccatcatcgtcgtcggcgcgggcatgaccggcctcgccgccgcctgggagctg
caacagaggggcgtgccgtatgtcctgctcgaagcgggagactctttcggcggcaaggta
cagagcgagcgcacggaggacgaatttctggtggaaaaggccgccgacgccttcatcctc
ggcaagccctgggcgctgcaactcgcgcaggaagtcgggctgcaagacgaacttattcac
ccgcgcgcggagaccaaaaagctgtatttcctgcgcggcggcgagctgctcgactttccg
cagaacctgaaaatgttcgtgccgctcgacgacgagtcgtttctgcaaagcggcgtcctc
tcgccggagggtctgcgccggatgctcgacgagcagaacgtgccgcccaaagaaaacacc
gacgaggacgagtcgctcgccgacttcatcatccggcgcttcggggcggaggcaatgaat
ttcatcgtgccgctggcggctggcatttacgtcgccaatccctttgaactcagcatgaaa
gcagcgtttccgcagtttctcgcgctggagcagaaatatggcagcgtcatcaagggcagc
cgcgccacgccccgtgcccaggggccgattttcgggtcgttcaaggacggcatgtccacc
ctggcgaacgcggtggccgccaagctgaccggcgacgtgcggctgaatacgcccgtgctg
gccgttcacccggacggcgtaaccctaaccggcggcgaaaaaattgcggcaagcggcgtt
gttttaacggctcccgcctgggtcgccgcgccaacgctgggtcagagtttccccgcagcg
tccgcgctggtgggcgagctgcagacgaacggctcggtggccgttatcctcgcctaccgt
gaggggcagtttccccgcgacatgcacctgcacgggctccaagtcgccgccgacgagggc
atagagatgaaagccatcaccgtccactcggccaagctgcatggccgcgcgcccgaggga
cacgtgctgctgcgggtctttttcaaggacctggacccgcaaaaagccctggccgaggcg
gttcacgaagtcgcccggctgttcggcgcgcagggcgatccgctctggcacgcctatgcc
gactggcggggcaagaatccggcgtatcaggtggggcacctggaccacatcgcccgcatc
cgcgccgcgctgccgccgaatattcaggtggcggggtcgagttacacgggcgtcggcatt
cccgactgcgtgaacgcgggccggacggcggcgcgggatgtggttgccgcgctgggcgtg
gatgggtga

DBGET integrated database retrieval system