KEGG   Deinococcus radiodurans: DR_1313Help
Entry
DR_1313           CDS       T00025                                 

Definition
(RefSeq) L-allo-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
dra  Deinococcus radiodurans
Pathway
dra00260  Glycine, serine and threonine metabolism
dra01100  Metabolic pathways
dra01110  Biosynthesis of secondary metabolites
dra01120  Microbial metabolism in diverse environments
dra01130  Biosynthesis of antibiotics
dra01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dra00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DR_1313
Enzymes [BR:dra01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     DR_1313
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Cys_Met_Meta_PP
Motif
Other DBs
NCBI-GeneID: 1799483
NCBI-ProteinID: NP_295037
UniProt: Q9RUR9
Position
1:complement(1318472..1319500)
Genome map
AA seq 342 aa AA seqDB search
MVCAMTRPPLIADLRSDTVTKPTPAMREAMATAEVGDDVYGEDPNVNALQNELAHLTGFE
AGLFMPSGSMTNQVAIAVHTRRGEEVICAEGSHIYEWELGMMAAFSGVVPRFVPAPLGVP
SPEDVRLAVRRSVHQSPTGLISLENTHNKAGGTVIPLAVLRQMRAVADAEGLPLHLDGAR
VFNAAVKLGVDVREITRCFDTVSVCLSKGLGAPVGSVLLGSAQAIRQAHRYRKMLGGGMR
QAGILAAAARVALREGPARLADDHLRTRRLARALVEAGYDVDLAAVQTNIIYARLPEAER
RAAAWAEQGVLASALGHDSVRFVLHHQVDDDALDQAIRVLTA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggtgtgcgccatgacccgcccgccgctgatcgccgacctgcgctccgataccgtcacc
aagcccactcccgccatgcgtgaggcgatggcgaccgccgaggtgggcgacgacgtgtac
ggcgaagaccccaacgtcaacgccctgcaaaacgaactcgcgcacctgaccggctttgag
gcggggctgttcatgccgtcgggcagcatgacgaaccaggtggcgattgccgtgcacacc
cgccggggcgaggaagtcatctgcgccgagggcagccacatctacgagtgggaactgggg
atgatggcggccttttccggcgtggtcccgcgcttcgtgcccgcgccgctgggcgtgccg
agtcccgaggacgtgcggctggcggtccgccgcagcgtccaccagtcacccaccggcctg
atcagcctggaaaacacccacaacaaggccgggggcacggtgattccgctggcggtgctg
cggcagatgcgggcagtggccgacgccgagggactgcctctgcacctcgacggagcgcgg
gtcttcaacgccgccgtgaagctgggcgtggacgtgcgcgaaatcacgcgctgcttcgac
accgtgagcgtgtgcctgagcaaggggctcggcgccccggtgggcagcgtgctgctcggc
tcggcgcaggcgattcggcaggcgcaccgctaccgcaagatgctcggcggcgggatgcgg
caggccggaattctggcggcggcggcgcgggtggccctgcgcgaaggtccggcgcgactg
gccgacgaccacttgcggacccggcgattggcccgcgccctggtcgaagcgggctacgac
gtggacctcgccgccgtgcagaccaacatcatctatgcccggctgcccgaggccgagcgc
cgcgccgctgcctgggccgaacagggcgtgctcgccagtgcgctggggcacgactcggtg
cgcttcgtgctgcaccatcaggtggacgacgacgcgctcgaccaggccattcgcgtgctg
accgcctga

DBGET integrated database retrieval system