KEGG   Deinococcus radiodurans: DR_1475Help
Entry
DR_1475           CDS       T00025                                 

Definition
(RefSeq) 1-deoxy-D-xylulose-5-phosphate synthase
  KO
K01662  1-deoxy-D-xylulose-5-phosphate synthase [EC:2.2.1.7]
Organism
dra  Deinococcus radiodurans
Pathway
dra00730  Thiamine metabolism
dra00900  Terpenoid backbone biosynthesis
dra01100  Metabolic pathways
dra01110  Biosynthesis of secondary metabolites
dra01130  Biosynthesis of antibiotics
Module
dra_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:dra00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    DR_1475
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DR_1475
Enzymes [BR:dra01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.7  1-deoxy-D-xylulose-5-phosphate synthase
     DR_1475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_synthase_N Transket_pyr Transketolase_C TPP_enzyme_C Transketolase_N DUF1192
Motif
Other DBs
NCBI-GeneID: 1800297
NCBI-ProteinID: NP_295198
UniProt: Q9RUB5
Structure
PDB: 

Position
1:1487360..1489249
Genome map
AA seq 629 aa AA seqDB search
MNELPGTSDTPLLDQIHGPKDLKRLSREQLPALTEELRGEIVRVCSRGGLHLASSLGAVD
IITALHYVLDSPRDRILFDVGHQAYAHKILTGRRDQMADIKKEGGISGFTKVSESEHDAI
TVGHASTSLANALGMALARDAQGKDFHVAAVIGDGSLTGGMALAALNTIGDMGRKMLIVL
NDNEMSISENVGAMNKFMRGLQVQKWFQEGEGAGKKAVEAVSKPLADFMSRAKNSTRHFF
DPASVNPFAAMGVRYVGPVDGHNVQELVWLLERLVDLDGPTILHIVTTKGKGLSYAEADP
IYWHGPAKFDPATGEYVPSSAYSWSAAFGEAVTEWAKTDPRTFVVTPAMREGSGLVEFSR
VHPHRYLDVGIAEEVAVTTAAGMALQGMRPVVAIYSTFLQRAYDQVLHDVAIEHLNVTFC
IDRAGIVGADGATHNGVFDLSFLRSIPGVRIGLPKDAAELRGMLKYAQTHDGPFAIRYPR
GNTAQVPAGTWPDLKWGEWERLKGGDDVVILAGGKALDYALKAAEDLPGVGVVNARFVKP
LDEEMLREVGGRARALITVEDNTVVGGFGGAVLEALNSMNLHPTVRVLGIPDEFQEHATA
ESVHARAGIDAPAIRTVLAELGVDVPIEV
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgaacttcccggcacgtccgataccccgctgctcgaccagattcatggccccaaa
gacctcaaacgcctctcgcgggagcagttgcccgcgctgaccgaggagctgcgcggcgaa
atcgtgcgtgtctgctcgcgcggcggcctgcacctcgcgtcctcgctcggcgcggtggac
atcatcacggcgctgcattacgtgctcgactcgccgcgcgaccggattctcttcgacgtg
gggcatcaggcctacgcccacaaaatcctgaccgggcggcgcgaccagatggccgacatc
aagaaagaaggcggcatcagcggctttaccaaggtttccgagtccgaacacgacgcgatt
acggtgggccacgcctccacctccctcgccaacgcgctcggcatggcgctcgcgcgtgac
gcgcagggcaaggatttccacgtcgctgccgtcatcggcgacggctcgctgaccggcggg
atggccctcgccgcgctcaacaccatcggcgacatgggccgcaagatgctgatcgtgctc
aacgacaacgagatgagcatctcggaaaatgtcggggccatgaacaaattcatgcgcggg
ctgcaagtccagaagtggtttcaggaaggcgaaggtgcgggcaaaaaagcggtggaagcc
gtcagcaagccgctcgccgacttcatgagccgggcgaaaaactccacccgccacttcttc
gaccccgccagcgtcaaccccttcgccgcgatgggcgtgcgctacgtcggcccggtggac
ggccacaacgtgcaggaactggtgtggctgctcgaaagactggtggacctcgatggcccg
accatcctccacatcgtcaccaccaagggcaagggcctgagctacgccgaggccgacccg
atctactggcacggcccggccaagttcgacccggcgaccggcgagtacgtgccgagcagc
gcctattcgtggagcgccgccttcggtgaggccgtgaccgagtgggcgaagaccgacccg
cgcaccttcgtcgtcacgcccgccatgcgcgagggcagcgggctggtcgaattcagccgc
gtacacccgcaccgttacctcgacgtgggcatcgccgaggaagtcgcggtgacgacggcg
gcgggcatggcgctgcaagggatgcggcccgtcgtcgccatctactccaccttcctgcaa
cgcgcctacgaccaggtgttgcacgacgtggcgattgagcacctcaacgtcaccttctgc
atcgaccgcgcgggcatcgtgggggcggacggggccacgcacaacggcgtgttcgacctc
agcttcctgcgctctatccccggcgtccgcatcgggctgccgaaagacgccgccgaactg
cgcgggatgctcaagtacgcccagacgcacgacggcccctttgccatccgctacccgcgc
ggcaatacggcgcaggtgcccgccgggacgtggccggacctgaaatggggcgagtgggaa
cggctgaaggggggcgacgacgtggtgattctggcgggcggcaaggcgctcgactatgcc
ttgaaggccgccgaggacctccccggtgtgggcgtggtcaatgcccgcttcgtcaagccg
ctcgacgaagagatgctgcgcgaggtggggggccgggcccgcgccctgattacggtggaa
gacaacaccgtcgtcggcggcttcgggggcgcggtgctcgaggcgctgaacagcatgaac
ctgcatcccaccgtgcgcgttctcggcattcccgacgagtttcaggaacacgccactgcc
gagagcgtccacgcccgcgccggcatcgacgccccggcgattcggacggtgctcgccgaa
ctcggggtggacgtgccgattgaggtgtag

DBGET integrated database retrieval system