KEGG   Deinococcus radiodurans: DR_1822
Entry
DR_1822           CDS       T00025                                 

Definition
(RefSeq) bifunctional preprotein translocase subunit SecD/SecF
  KO
K12257  SecD/SecF fusion protein
Organism
dra  Deinococcus radiodurans
Pathway
dra02024  Quorum sensing
dra03060  Protein export
dra03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:dra00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    DR_1822
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    DR_1822
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    DR_1822
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dra02044]
    DR_1822
Secretion system [BR:dra02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   DR_1822
SSDB
Motif
Pfam: SecD_SecF Sec_GG MMPL Sterol-sensing DUF4131
Other DBs
NCBI-GeneID: 1799461
NCBI-ProteinID: NP_295545
UniProt: Q9RTE3
Structure
PDB: 
5XAP 5XAN 5XAM

Position
1:1846843..1849149
AA seq 768 aa
MTYGSKQVRKTSGSNRRPPPPRRSGGVSRPNPWTALLLLLTLLGSLLYIWRPWEHKNDPW
SLWNDQYQFMTLGLDLKGGLRIELAPESGTATRDELDRVKTVIENRINALGVAEPTVTVS
GGKRVVVEIPGATPAVQDRARSIIQQTARLEFRIVNSDAKPDPAVREKNPRSSGYTLAQL
GPVVATGETIADATSGTDQRSGQWVVNFKTTDAGAKTFGDFTGKNVNRLMAVVLDDQIQS
VATINQRLFRDIQISGNFTPEEASQLALVLKSGALPIKIVTAAERSIGPSLGADAIRSGA
IAALVGIGLVFVMLFAYYGLWFGLVGALGLLFSSIIILGILGGFGATLTLPGIAGLVLTI
GAAVDGNVISFERIKEELARGKGIKNAIGAGYEHSTAAILDVNASHLLSALALYNYSTGA
VKGFAVTLIIGVIASTFSNLVFAKWFMQWLAQRRPNMSAPQWIKHTHFDFMKPAKVITTL
SVLLALAGAALVATRGLNYGVDFAPGTTLTARVDRQVTTEQLRNSVIGAGVSKVTGQSAT
IQRDTTPGQQGQNFTVKVPELNDAEVKQIGAAIGKLPQGQVLASETVGPAVGKELTQKTI
YAVLLGLGLILVYVGFRFDFIMGLGSIIAAIHDVAIAMGLFSLLGLEFTVASVAALLTLI
GYSLNDSIIVSDRIRENMKTMRGHSYREIVNAAINQTLSRTVMTSVSTMLPLISLLIFGG
PVLRDFSLILLVGILVGTYSSIYIVAPLVVYFEEWRDKNRAAKPVTNS
NT seq 2307 nt   +upstreamnt  +downstreamnt
atgacctacggcagcaaacaagttcgcaagacgagcggcagcaaccgccgcccccctccc
ccacgccgcagcggcggggtcagccggcccaacccctggaccgcgctgctgctgctgctc
accctgctcggcagcctgctctacatctggcggccctgggaacacaaaaacgatccctgg
tcgctgtggaacgaccagtaccagttcatgacgctgggcctcgacctcaagggcggcctg
cgcatcgagctcgcccccgagtcgggcaccgccacccgcgacgaactcgaccgggtgaag
accgtcatcgaaaaccgcatcaacgcgctgggggtcgccgagcccaccgtgaccgtctcg
ggcggcaagcgcgtggtggtcgagattccgggcgccacgcccgccgtgcaggaccgcgcc
cgcagcatcattcagcagaccgcgcggctggaattccgcatcgtcaactcggacgccaag
cccgacccggcggtgcgtgagaagaacccgcgcagcagcggctacacgctcgcgcagctc
gggccggtcgtggcgaccggggaaaccatcgccgacgcgacctcgggcaccgaccagcgc
tccgggcagtgggtcgtcaacttcaagaccaccgacgcgggcgccaagaccttcggcgac
tttaccggcaagaacgtcaaccgcctgatggccgtggtgctcgacgaccagattcagtcg
gtcgccaccatcaaccagcgcctgttccgcgacatccagatcagcggtaacttcacgccc
gaggaagccagccagctcgcgctggtgctcaagtccggcgccctgcccatcaagatcgtg
accgccgccgagcggtccatcgggccgtcgctgggggccgacgccatccgcagcggcgcg
attgccgcgctggtcgggattgggctggtgttcgtgatgctcttcgcgtactacggtctg
tggttcgggctggtcggcgcgctcggcctgctgttttcgagcatcatcatcctgggcatt
ctgggcggcttcggcgccacgctgacgctgccgggcatcgcgggtctggtgctcaccatc
ggcgctgctgttgacggcaacgtgatttcctttgagcgcatcaaggaagaactcgcgcgc
ggcaagggcatcaagaacgccatcggtgccgggtacgagcactccaccgccgccattctg
gacgtgaacgcctcgcacctgctctcggcgctcgcgctctacaactactccactggggcc
gtgaagggcttcgccgtcaccctgattatcggcgtgatcgcctccaccttttccaacctg
gtgttcgccaagtggttcatgcagtggctcgcgcagcgtcggcccaacatgagcgccccg
cagtggatcaagcacacccacttcgacttcatgaagcccgccaaggtcatcaccaccctg
tcggtgctgcttgccctcgcgggcgcggcgctcgtcgccacccggggcctgaactacggc
gtggacttcgcgcccggcaccaccctcaccgcccgcgtggaccggcaggtgaccaccgag
cagctccgcaacagcgtgatcggggcgggtgtgtccaaagtcaccggccagagcgccacc
attcagcgtgacaccacgccgggacagcagggccagaacttcaccgtcaaggtgcctgag
ctgaacgacgccgaggtcaagcaaatcggcgccgccatcggcaagctgccgcaggggcag
gtgctcgccagcgaaacggtggggccggcggtgggcaaggaactgacgcaaaagaccatc
tacgccgtgctgctcggcctgggcctgattctggtctatgtcggcttccgcttcgacttc
atcatgggtctgggcagcatcatcgccgctattcacgacgtggcgattgccatgggcctc
ttctcactgctgggactggaattcaccgtggcctcggtggccgcgctgctgaccctgatc
ggctactcgctcaacgactcgattatcgtttcggaccgtatccgcgagaacatgaagacc
atgcgcggccacagctaccgcgaaatcgtcaacgccgccatcaaccagacgctctcgcgc
accgtcatgacctcggtcagcaccatgctgccgctgatcagcctgctgattttcggtggc
ccggtgctgcgcgacttcagcttgattctgctcgtcggcatcctcgtcggcacctactcc
tcgatctacatcgtcgcgccgctcgtcgtgtatttcgaagaatggcgggacaagaaccgc
gccgcgaagccggtgacgaacagctga

DBGET integrated database retrieval system