KEGG   Deinococcus radiodurans: DR_1980Help
Entry
DR_1980           CDS       T00025                                 

Definition
(RefSeq) hypothetical protein
  KO
K00329  NADH dehydrogenase [EC:1.6.5.3]
K00356  NADH dehydrogenase [EC:1.6.99.3]
Organism
dra  Deinococcus radiodurans
Pathway
dra00190  Oxidative phosphorylation
Brite
KEGG Orthology (KO) [BR:dra00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    DR_1980
Enzymes [BR:dra01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     DR_1980
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     DR_1980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase 3Beta_HSD RmlD_sub_bind NAD_binding_10 NAD_binding_4 GDP_Man_Dehyd adh_short adh_short_C2 Sacchrp_dh_NADP
Motif
Other DBs
NCBI-GeneID: 1798725
NCBI-ProteinID: NP_295703
UniProt: Q9RSY9
Position
1:2002633..2003598
Genome map
AA seq 321 aa AA seqDB search
MRGMAEQAEHPSRILVTGASGFVGRATLAELTRRGYEVVAGSRQGKGVGRGIGIKLDVTS
EKSVRQALQDVQPAAVIHLVGIIAEKGKQTFERVHIEGTRHVLDALRDYDAARQQAHKGD
EMERPHPTRYLHMSALGADVLSPSAYSWSKGEAEGLVRLSGLPWTIFRPSLIFGVGDDFF
GRVLKNLVSAAPVVPQIGDGQFPFRPISVEDVALAFAEALVKPETVGQIYALTGPQEFTF
KELLALEQQALGQQKKVVPVPQKLMDLAVPVISRLPAAPITRDQYAMLKAGNTAPNDAAR
AAFNLPLHRLQDRLPYIVDRK
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgcggggtatggctgagcaagcagaacatccctcccgcatcctcgtgaccggcgcgagc
ggcttcgtgggccgcgccaccctagccgaactcacccggcgcggctacgaggtcgtcgca
ggctcacggcagggcaagggcgtgggccggggcatcggcatcaagctggacgtgacgagt
gaaaaaagcgtgcggcaggcgcttcaggacgtgcagcccgccgccgtcattcatctggtg
ggcatcatcgccgagaaaggcaagcagaccttcgagcgtgtgcatatcgagggcacccgg
catgtgctggacgccctccgcgactatgacgctgcccggcaacaggcccacaagggcgac
gagatggagcgcccccaccccacccgctacctgcacatgagcgcgctcggcgccgatgtc
ctgagccccagcgcctactcgtggagcaagggcgaggccgaggggctggtgcgcctcagc
gggctgccctggaccatcttccgccccagcctgattttcggcgtgggcgacgactttttc
gggcgggtgctgaaaaatctggtgtcggcggccccggtggttccccaaatcggagacggg
caattccctttccgccccatcagcgtggaggacgtggcgctggcctttgcggaggcgctg
gtcaagccggaaacggttggacagatttatgcgctcaccggcccgcaggagttcaccttc
aaggagttgctggcgctggagcagcaggcgctcggtcagcaaaaaaaggtggtgccggtg
ccccagaagctgatggacctcgccgtcccggtcatcagccgcctgcccgccgcgcccatc
acccgcgaccagtacgcgatgctcaaggccggcaacaccgcaccgaacgacgccgcccgc
gccgccttcaacctgccgctgcaccgcttgcaggaccggctgccgtacatcgtggaccgg
aaataa

DBGET integrated database retrieval system