KEGG   Deinococcus radiodurans: DR_2129Help
Entry
DR_2129           CDS       T00025                                 

Gene name
rplQ
Definition
(RefSeq) 50S ribosomal protein L17
  KO
K02879  large subunit ribosomal protein L17
Organism
dra  Deinococcus radiodurans
Pathway
dra03010  Ribosome
Brite
KEGG Orthology (KO) [BR:dra00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    DR_2129 (rplQ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:dra03011]
    DR_2129 (rplQ)
Ribosome [BR:dra03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    DR_2129 (rplQ)
  Bacteria
    DR_2129 (rplQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L17
Motif
Other DBs
NCBI-GeneID: 1797678
NCBI-ProteinID: NP_295852
UniProt: Q9RSJ5
Structure
PDB: 

Position
1:2132212..2132562
Genome map
AA seq 116 aa AA seqDB search
MRHGKAGRKLNRNSSARVALARAQATALLREGRIQTTLTKAKELRPFVEQLITTAKGGDL
HSRRLVAQDIHDKDVVRKVMDEVAPKYAERPGGYTRILRVGTRRGDGVTMALIELV
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcacggtaaagccggtcgcaagctcaaccgcaacagcagtgcccgcgtcgccctg
gcccgtgcccaggcgaccgccctgctgcgcgagggccgcatccagacgaccctcaccaag
gccaaggagctgcgccctttcgtcgagcaactgatcaccaccgccaagggcggcgacctc
cactcgcgccgcctcgtcgcccaggacatccacgacaaggacgtcgtgcgtaaggtcatg
gacgaagtggcccccaagtacgccgagcgtcccggtggctacacccgcatcctgcgcgtg
ggcacccgccgcggtgacggcgtcacgatggccctcatcgaactggtctga

DBGET integrated database retrieval system