KEGG   Deinococcus radiodurans: DR_A0243Help
Entry
DR_A0243          CDS       T00025                                 

Definition
(RefSeq) flavohemoprotein
  KO
K05916  nitric oxide dioxygenase [EC:1.14.12.17]
Organism
dra  Deinococcus radiodurans
Brite
Enzymes [BR:dra01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.17  nitric oxide dioxygenase
     DR_A0243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_1 Globin FAD_binding_6 NAD_binding_6 Protoglobin
Motif
Other DBs
NCBI-GeneID: 1798115
NCBI-ProteinID: NP_285566
UniProt: Q9RYR5
Position
2:254098..255309
Genome map
AA seq 403 aa AA seqDB search
MLTPEQKAIVKATVPALEAHGETITRTFYASMFAAHPELLNIFNPANQQTGKQARSLAAS
VLAYAAHIDHPEALGGMVGRIAHKHVSLEVLPEHYPIVGQYLLGAIAGVLGDAAKPEILD
AWAAAYGELADLMIGIEKGMYDAGAGQPGGWRDFRPFRVARKVAESRVITSFVLEPVGGG
ALPAYQPGQYLSLKVKVPGQERWQIRQYSLSDAPSPDHYRISVKREGGGLVSEYLHGAVQ
EGDELLVHVPAGDFVLQQSERPVVLISAGVGITPMLAMVQTLAQAGSQRPVTFIHAAQNG
SVHAFRDDVARLTHEYPHFRKVVFYDEAGPDDQLGTHHDVAGRLSLDAVRGALPAGEAEF
YYCGPAGFAGAVEAILDDLQVPAERRFTETFGPSQSFAPVILG
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgctgacccccgaacagaaagccatcgtcaaggccaccgttcccgcgctggaagcgcac
ggcgagacgatcacccgcaccttctacgcctcgatgttcgccgcgcaccccgaactgctc
aacatcttcaaccccgccaaccagcagaccggcaagcaggcccgcagcctggcggcgtcg
gtgctggcctacgcggcacatatcgaccatccggaggcgctgggcggcatggtggggcgg
attgcccacaagcacgtcagcctggaagtcctgcccgagcattaccccatcgtgggccag
tacctgctcggcgcgattgccggggtgctgggcgacgccgccaagccggagattctggac
gcctgggccgccgcctacggggagctggccgacctgatgatcgggatcgagaagggcatg
tacgacgccggagccgggcagcccggcggctggcgcgacttccggcccttccgggtcgcc
cgcaaggtggccgagagccgcgtgatcacctccttcgtgctcgagcccgtgggcggcggg
gcgttgcccgcctatcagccggggcagtaccttagcctgaaggtgaaggtgccggggcag
gagcggtggcaaatccggcagtacagcctctcggacgcgccgagcccggaccactaccgc
atctcggtcaagcgcgagggcggcgggctggtgtcggagtacctgcacggcgcggtgcag
gagggcgacgaactgctcgttcacgttccggcgggcgacttcgtgctgcaacagagtgag
cgcccggtggtcctgatcagcgcaggcgtgggcatcaccccgatgctggcgatggtgcag
acgctggcccaggcggggtcgcagcggcccgtcaccttcatccacgcggcgcagaacggc
tccgttcacgccttccgcgacgacgtggcgcggctgacgcacgagtacccgcactttcgc
aaggtggtcttctacgacgaggccggccccgacgaccagctcggcacccaccacgacgtg
gccgggcgcctgagcctggacgccgtgcggggcgcgctcccggcgggtgaggccgagttc
tactactgcggtccggcgggcttcgccggggcggtggaagccatactcgacgacttgcag
gtgcccgccgagcgacgctttaccgaaaccttcgggccgagccagagcttcgcgccggtg
attctgggctga

DBGET integrated database retrieval system