KEGG   Danio rerio (zebrafish): 100000034
Entry
100000034         CDS       T01004                                 

Definition
(RefSeq) chemokine CCL-C25y-like precursor
Organism
dre  Danio rerio (zebrafish)
SSDB
Motif
Pfam: IL8 OrfB_Zn_ribbon
Other DBs
NCBI-GeneID: 100000034
NCBI-ProteinID: NP_001122280
UniProt: B0V353
Position
25
AA seq 98 aa
MSTSRFVFLSAVVVLLCAVSLSQGMRIGPKRCCFQYAERQVPFKQVMEYSMTSQQCPKEA
VLFKTARGRYVCARPSDPWVQEYMQAIDSKRVGNQGTL
NT seq 297 nt   +upstreamnt  +downstreamnt
atgagcacctctcgctttgtgtttttatctgctgttgtggtgctgctgtgtgccgtcagc
ctcagtcaaggtatgcgcattggaccaaagagatgctgtttccagtatgcggaacgtcaa
gtgcctttcaaacaagtaatggaatacagcatgacaagccagcagtgccccaaagaagcc
gtcctgttcaagactgcaaggggacgttacgtgtgtgccagacccagtgatccctgggta
caggagtacatgcaggccattgacagcaaacgtgttggcaatcaggggaccctgtaa

DBGET integrated database retrieval system