KEGG   Danio rerio (zebrafish): 100000140
Entry
100000140         CDS       T01004                                 

Gene name
si:dkey-225f5.5
Definition
(RefSeq) major histocompatibility complex class I-related gene protein isoform X2
Organism
dre  Danio rerio (zebrafish)
SSDB
Motif
Pfam: C1-set MHC_I
Other DBs
NCBI-GeneID: 100000140
NCBI-ProteinID: XP_001340413
ZFIN: ZDB-GENE-141216-18
Ensembl: ENSDARG00000055813
Vega: OTTDARG00000042278
UniProt: A0A0R4IZK4
Position
3
AA seq 350 aa
MMYLVLAVCILSASVFSQSGSHSLWVFATFLTGDISVQFPEFSAVVMLDDIVIGHYNADD
RSFVPSTVQESVNITEQITISTVCKGIHEGMKTKAYYLIDYLNHTRGLHVQQRLVGCELL
QNEPGQMMTLEAFNGESGFERRYDIQGDQQTHWKWPVIKSRAQLEYDAWLYAHFYRPLCI
SQLRKYLKKEKKRVMARVKPRVRVIQRTCSKTGKIQMTCLATGFYPRHINLTLLQDGQPV
NEERVMGGELLPNADGTYQMRKSVELSAEEQRERRTYTCTVNHLSLDNKLDISIEPGLDP
VIIFPSVLLLLCVFGVLAGFLMWRKKYKQPEQVTYTPTSATDQTTEQSQL
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgatgtatttagtccttgcagtgtgcatactgtcagcctcagtgttttctcagtcaggg
tcacattcgctctgggtcttcgctacatttttgacaggagacatctcagtccaattccca
gagttcagtgcagttgtaatgctggatgatattgtgatcggccactataacgcagatgac
agaagttttgtcccgtcgacggtgcaagaatctgttaatataaccgagcaaatcactata
tcaacagtctgtaaaggcatacatgaaggcatgaaaaccaaagcgtactacttaatcgat
tacttaaaccatacaagaggtctacatgtgcagcagaggctggttggatgtgaacttctt
caaaatgagcccggccaaatgatgacactagaggccttcaatggtgagagtggttttgaa
agacgctatgacattcagggagaccaacaaactcactggaaatggcctgtcattaagagt
agggcacagctggagtacgatgcatggctgtatgcacacttttaccgccctttgtgcatt
agccagcttcggaaatatctaaagaaggagaagaagcgtgtgatggcaagagtaaagcct
agagtgagggtgattcaacgcacctgtagtaagactggaaaaattcagatgacctgcctc
gcaactggtttctacccacgtcacattaatctgactctgcttcaagatggccagccagtc
aatgaggaaagggtcatgggtggagaactgttgccaaatgctgatggaacataccagatg
aggaagagtgtggaactcagcgctgaagagcaaagagaaagacgcacatacacatgcact
gtcaatcacctcagcttggacaacaaacttgacatcagtatagaacctggtctcgatcca
gttattatctttccctctgtgctacttttgctgtgtgtgtttggagttcttgctggattt
cttatgtggcggaagaaatataaacagcctgagcaggtcacatatacacctacttcagca
actgatcaaacaacagaacaatcccagctgtga

DBGET integrated database retrieval system