KEGG   Danio rerio (zebrafish): 100000353
Entry
100000353         CDS       T01004                                 

Gene name
ttbk1b
Definition
(RefSeq) tau-tubulin kinase 1 isoform X1
  KO
K08815  tau tubulin kinase [EC:2.7.11.26]
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    100000353 (ttbk1b)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     100000353 (ttbk1b)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: CK1 group
  TTBK family
   100000353 (ttbk1b)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr
Other DBs
NCBI-GeneID: 100000353
NCBI-ProteinID: XP_017207296
ZFIN: ZDB-GENE-100609-5
Ensembl: ENSDARG00000056659
Vega: OTTDARG00000038676
UniProt: X1WBG3
Position
17
AA seq 1219 aa
MQCVGPGVHGDENMNGAGEQVDILPSNCLVKDRWKVLKKIGGGGFGEIYEAYDLLTRENV
ALKVESAQQPKQVLKMEVAVLKKLQGKNHVCKFIGCGRNDKFNYVVMQLQGRNLADLRRS
QPRGTFSMSTTLRLGKQILESIEAIHSVGFLHRDIKPSNFAMGRLPSTCRKCYMLDFGLA
RQYTNTNGEVRPPRSVAGFRGTVRYASINAHKNKEMGRHDDLWSLFYMLVEFTVGQLPWR
KIKDKEQVGQIKERYEHRMLLKHMPAEFHIFYDHVLDLDYFTKPDYQLLMSVFENSMKDR
VITENEPYDWEKSGTDTALPTSTHTPPQQNTRQTAAIVGVVNVTPVPGELPRENTDDVLQ
DEHLSDQENAPPALIPSRPSEPAPAAPAGEAWDETDFNRNQLRISISKTQVAAEDGDEPA
GGGRSVSPARGGEGDAQARPPRYRRVNSPESERLSGAEDRGDGADKRSRLDMLGSPSRHV
YSSQPAQMLSLEGGQGERLAGGRHDVSADGDQEAHSNAFIRSVPLAEEEDFDSREWVMID
KETELKDFLPGAEPTTSGTTDEEPEELRPLEDHEERRRRVHGGAEAVVRPKTQRGMMIVA
EEEGAGPSPGHSSCHTLPRSCPRRRESEPFGPDGPDIAVAEPSPSFSQTRMKRVDFVSGV
LMFDDLREEVVKTGGSGSDGSPRSSEGSPEGAASTLLAPAHRDHDQEEGSRTLVLVSAGN
GQVSPGDGQGTLAALTPQGERPVPEESEPGTLSSVIKSEPRPIVMTTAAVITSGSSSPPF
TKVERTFIHIAETSHLNVMTARHRPSGFDEPISVEREEMGEEKEDRAGQLVEIERNSEGI
KVEREGDEKKKEESEAEKEKQEVENVIISSREEAETVFLAEQPVSIAIKENISIETKLDD
EQDGVTTEKEQEQEESPSVSPEQNRDAEVEDEKDVSPPEVESPDRKPLPQRRSRIPVLMS
EDETGSDKSSQTSQEQLQRTRKSRHQQLARLVLERKQTHMMRSRSASSHSPTLSTTASED
EAHQSDDSAKGADGKIKSRIPRPVTPIRGSYDLLKCTTLPQTQRSVSFIQYRTNSSINPK
IQKSASLHTNIHQQPPKPQLRPSKTLPPLPPSSGPSHTQGSRTATRTVTRTSAPNATRSI
STSPRSYGTSRTDSPSPQRIRRQLAANETQRQAQQPRPPVPSVSKSKPQDSTTPRKSKSH
PSTSTKAKKDPLESKTKTR
NT seq 3660 nt   +upstreamnt  +downstreamnt
atgcagtgcgtagggcccggagtccacggcgacgaaaacatgaacggggcgggagagcag
gtcgacatcctgccctccaactgcttggtgaaagatcgctggaaagtgctaaagaagatt
gggggtggagggtttggggagatatatgaggcctacgacttgttgacgcgggagaatgtg
gctcttaaggtggaatctgcccaacaacccaaacaagtgctaaagatggaggttgctgtg
ctaaagaaactacaaggaaagaatcatgtttgcaaattcattggatgtggaagaaacgac
aagttcaattatgttgtcatgcagctgcaggggaggaatcttgctgatctcaggaggagt
cagcctagggggacatttagcatgagcaccacgctacggttggggaaacagatccttgag
tccattgaagccattcactctgtgggcttcctgcaccgagacattaaaccttctaatttc
gctatgggtcggttgccgtcaacttgtaggaagtgttacatgctggattttggtttggca
cgacagtacacaaatacaaatggggaggtgcggccgcccaggtcagtggctgggttcaga
ggaacggtgcgatacgcttccattaatgctcataaaaacaaggaaatgggtcgtcatgat
gatttgtggtcgttgttttatatgctggtagagtttaccgttggacaattaccatggcgt
aagataaaagataaggagcaggtgggacagattaaagaacgctacgagcacaggatgctg
ttgaaacacatgcctgcagagtttcatatcttttatgatcatgtgctggatttggattat
ttcaccaaacctgattatcagttgctgatgtcagtatttgagaacagcatgaaagacagg
gtgataactgaaaacgagccgtatgactgggaaaaatctggaacagatacggcactccct
accagcacacacacaccaccacagcaaaacacaaggcaaactgctgccattgtgggggtg
gtaaatgtgactccagtacccggtgaactaccaagggaaaacactgatgatgttctgcaa
gatgaacacctgagtgaccaagagaatgctccacctgctttaatacccagcaggccgagc
gaaccggctccagccgcacctgcaggtgaagcatgggatgaaactgacttcaatagaaac
caactcaggatcagcatcagtaagacacaagtagcagcagaggatggagatgagcctgct
ggaggagggaggtctgtttctccagccaggggtggggaaggtgatgctcaggctcgtcct
ccaaggtaccggagagtcaacagccctgaatcagagcgtttgtctggtgcagaggataga
ggagatggtgcagataaacgctctcgtctggacatgctgggctctccatccaggcatgtc
tactcttctcagcctgctcagatgctctccttagagggtggacagggagaaaggttggcc
ggcggccgtcatgatgtctctgcagacggtgaccaggaggcccacagcaatgccttcata
cgctcagtcccgctggcagaggaagaggacttcgacagcagggagtgggtgatgatcgat
aaagaaactgagctgaaggacttcctccccggggcagaaccaaccacctcaggcaccaca
gatgaggaacctgaggaattgcggcccctcgaggaccacgaggagaggagaaggagagtg
catggaggagctgaggctgtggttcgacctaaaacacagcgagggatgatgattgtagca
gaggaggagggagcagggccgagtcccggccattcatcctgtcacacgctgcctcgttcc
tgcccgagaagaagagagtcggagccgtttggacctgatggaccggacatcgccgtggct
gaaccttcgccttcgttctctcagacgcgtatgaagcgagtggactttgtgtctggtgtt
ttgatgtttgatgatctgagagaggaggttgtgaagactggaggttcaggaagtgatggg
agcccacgcagtagtgagggaagcccggaaggggcagcgtccaccctactcgcccctgca
catcgagaccatgaccaggaagagggctcacgcacactggtgcttgtgtctgccggtaac
ggacaagtttcacctggggatgggcagggaacgcttgctgctttgacaccgcagggagag
cgacctgtgccagaagaatctgaacctggcactctttcctctgtcattaaatcagagccc
aggcctatcgtcatgacaactgcggctgtgatcaccagtggttcttcctcgccacctttt
actaaagtggagcgcactttcatccacatcgctgagacgtcacatcttaatgtcatgaca
gccagacaccgtccgtctggattcgatgagccgatatctgttgagcgtgaggaaatgggg
gaagagaaagaggatcgggcagggcaactagtggagatagagaggaatagtgaagggatt
aaggtggaaagggaaggggatgagaagaaaaaggaagaaagtgaagctgagaaggaaaag
caggaagtagaaaatgtaattattagtagcagagaggaagcagagactgtgtttttagct
gagcagccagtgtctatagctattaaagaaaatatttcaatagaaaccaaattagatgac
gaacaagatggtgtcacaacagagaaagaacaggagcaagaagagagtccatctgtgtcc
cctgaacaaaacagagatgctgaagtagaggatgagaaggatgtgtctccaccagaggtg
gagtcacctgatagaaagccactcccacaaaggcggagccgtattcctgtgctcatgtca
gaggatgaaacgggctcagacaagtcatcgcagacgagtcaagagcagttgcaacgaact
cgcaaaagcagacaccaacagttggcccgtctggttctggagcgtaaacaaacgcatatg
atgcgctctcgttctgcctcctcacactccccaacactctccaccactgcatctgaggat
gaagcccaccaatctgatgactccgctaaaggagcggatgggaaaattaagagcaggatc
cctcggccagtcacgcctatcagggggtcttacgacctgttaaagtgcacgactctaccg
caaacccagagatctgtgtcttttattcaatacagaaccaacagttctatcaatcccaag
attcagaaatctgcaagtctgcacacaaatattcatcagcagccgcctaaacctcagctc
cgcccctctaaaacacttccaccccttcctccatcttcaggtccttcccacactcaagga
agccggacggccacacgtaccgttactcgtacctcagctcctaatgccaccagaagcatc
agtacttccccgcgaagctacggcacctcccgcaccgacagcccctcgcctcagcgcatt
cgacgacagcttgcagccaatgaaacgcaacggcaagcccagcagcccagacctccagtc
ccgtctgtgtccaaatccaaacctcaggactccaccaccccaagaaagagcaaatcccac
ccatcaacctcaacaaaagcaaagaaagatccactggagtcaaaaacaaaaacaagataa

DBGET integrated database retrieval system