KEGG   Danio rerio (zebrafish): 100000723Help
Entry
100000723         CDS       T01004                                 

Gene name
qdprb2
Definition
(RefSeq) quinoid dihydropteridine reductase b2 precursor
  KO
K00357  dihydropteridine reductase [EC:1.5.1.34]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00790  Folate biosynthesis
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100000723 (qdprb2)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     100000723 (qdprb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short Epimerase adh_short_C2
Motif
Other DBs
NCBI-GeneID: 100000723
NCBI-ProteinID: NP_001103180
ZFIN: ZDB-GENE-070720-19
UniProt: A7MC04
Position
1
AA seq 257 aa AA seqDB search
MLTFGILLILMVLNSSLAFSEVKKVIVYGGTGALGLESVRYFRAQNWWVASIAHSVNKEA
SANVKVKMTESFTDQAKQVTVGVGKLLGDEKVDAIYCVAGGQAEGNAKANSLYKYADLMW
KENVWTSTICTHLATKYLREGGLLTLSGAKVAQGPTAESVSFGMAKASVHQLTQSLSGPN
SGLPPRSVALAILPETLDTPTNRRIMPNADVSSWTPLNHVTQLFFKWTVGESRPPSGSLV
ELVTANGRTVATPIKSP
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgcttacttttggtatcctccttatcttaatggttctgaattccagtctggccttcagc
gaagtaaagaaagtgattgtttatgggggaactggagcactgggcctagagagtgtacgt
tatttcagagcccaaaattggtgggttgcctctattgctcatagtgtcaacaaagaagcc
agtgcaaatgttaaagtaaagatgactgaatccttcactgatcaagccaaacaggtaaca
gtgggtgttggtaaactgttgggtgatgagaaagttgatgccatctactgcgtggctgga
ggtcaagcagagggcaatgctaaagccaactctctgtacaagtatgctgatctgatgtgg
aaggagaatgtgtggacctccaccatttgtactcacctagcaacaaaatacctgagagag
ggtgggctgctcacattgtcaggggccaaagtagcgcaggggccaacagcagaatctgtt
agttttggaatggcaaaggcatctgtacatcagctgacccagagtctcagtgggccgaac
agtggtcttccaccgcgatctgttgctctagcaatccttccggaaactttggatacaccc
acaaataggaggatcatgcctaatgccgatgtcagttcctggaccccactaaatcatgtt
acccagctgttctttaagtggactgttggagaaagcagaccaccttcaggtagtctagtg
gagcttgttaccgctaatggcagaacagtggctacccctattaaaagcccttag

DBGET integrated database retrieval system