KEGG   Danio rerio (zebrafish): 100000903Help
Entry
100000903         CDS       T01004                                 

Gene name
prf1.1
Definition
(RefSeq) uncharacterized protein LOC100000903 precursor
  KO
K07818  perforin 1
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:dre00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100000903 (prf1.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MACPF C2
Motif
Other DBs
NCBI-GeneID: 100000903
NCBI-ProteinID: NP_001304691
ZFIN: ZDB-GENE-111212-2
Ensembl: ENSDARG00000030394
Vega: OTTDARG00000035073
UniProt: E7FA66
Position
3
AA seq 580 aa AA seqDB search
MRAGLFFYLLLPVVQSCTKGKPKECEEATFAPGSNLAGEGYDVIKMQRKGAFVINTDVWR
QKDKSCTLCKNPYMDGALQKLPLSVVDWRTSQKCTVKVSSSLYHSSEDLVSSSASSIENN
WGASLGIEAKKTTGSIVLAGSKSKLAEYSMEKTKKDKFNFASQSISCAYYSYRVSNKPVL
HPEFKRSVKELPKTYNLQFKPRFYKFINTFGTHYITKVTLGGNVHSVTSIRQCETALQGL
STDEVKACLDLEANMSILGKADMKAESKHCSQNQDKTESKTSFSSRFNDRLTEVTGGHTT
EPELLFSGGKDPSAYKEWLASLPQNPDVISHSLESLHELIPTKYPVRKHMRQAIHDYILE
NSLWRNCTDPCTNGVKTNPNNPCVCTCHNKPGITPDCCPSKRGLSRVQVTVVKAQDLWGD
TTTATDGYVKVFDKNNVKIGSTNMIPNNNSPYWGQTFDLGDVILAENDNIKLEVWDEDSK
WDDDLLGTCQVAIKVDQSQTYNFCSLNHGLLYYNTKVTCAPGLAGTYCEKYVGSPMNFHL
EKVYVSRNARPVPPEILLSHGVLLDRLYVYHKTNYNNTVL
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgagggctggattgtttttttaccttctcttgcctgttgtgcagtcctgcactaaaggt
aaacccaaagagtgtgaagaagcaacctttgcacccggatctaacctggccggagaagga
tacgacgtgatcaagatgcagcgcaagggagcttttgtcatcaacacagacgtctggagg
caaaaggacaaatcctgcaccctctgcaagaacccctatatggacggagctttacaaaag
cttcctctgtcagtggtggactggagaaccagccaaaaatgcaccgtgaaagtctccagt
tctctataccattccagcgaggacctggtgagctccagcgcctcctctattgagaacaac
tggggtgcaagtttggggatagaggctaaaaaaacaacaggctcgatagttttggcagga
agcaagtcaaagcttgcagagtactcaatggagaagaccaaaaaagacaagttcaacttt
gcaagtcaaagtatttcctgtgcttattacagctatcgagtctccaacaagcctgttctc
catcctgagttcaaacgatctgtgaaggagcttcccaagacatacaaccttcaattcaag
ccgcgtttctacaagttcattaacacctttggaacccattacatcacaaaggtaactctt
ggcggaaacgtgcactcagtgaccagtatcagacaatgtgaaaccgctcttcagggctta
agcacagacgaagtaaaggcctgcttggatttggaggcaaatatgagcattcttggcaaa
gcagacatgaaagccgaatcaaaacactgtagtcaaaatcaggacaaaacagagagcaaa
accagcttctccagccgcttcaatgacaggctgaccgaggtcaccggaggtcacaccaca
gagcccgagctccttttttcaggagggaaagacccatcagcttacaaagaatggctggcg
tccctgccgcaaaacccagatgtgatttctcactctctggagtccctgcacgagctgatc
cccaccaaatacccagtgcgcaaacacatgcgccaagccatccacgactacatcctggaa
aattccctttggaggaactgcaccgacccctgcactaatggcgtcaaaaccaacccaaac
aatccatgtgtctgcacttgccacaacaaacccggaatcacaccagactgttgcccgtcc
aaacgtggactctctcgggtgcaggtcacggtcgttaaggctcaagatctttggggtgac
acaaccacagcgaccgatggctatgttaaagtgttcgacaaaaataacgtgaagattgga
tccacaaatatgataccgaataacaattcaccctactgggggcaaaccttcgatctgggt
gatgtcatcctggcagagaatgacaatatcaaactggaggtgtgggatgaagacagtaaa
tgggatgacgatttgttgggaacctgtcaggtagccataaaagtagatcagagtcagacc
tacaatttctgcagtttgaatcatggtttgctctattacaatacaaaagtgacatgcgcc
cccggtttggctggcacctattgtgaaaagtatgtgggttcccccatgaactttcacctg
gagaaggtttacgtgtctcgaaatgcacgacctgtgccaccagaaatacttttaagccat
ggagtgcttctggacagactttacgtatatcacaagacaaattacaataatacagttttg
tag

DBGET integrated database retrieval system