KEGG   Danio rerio (zebrafish): 100000934
Entry
100000934         CDS       T01004                                 

Gene name
unc93b1
Definition
(RefSeq) protein unc-93 homolog B1
Organism
dre  Danio rerio (zebrafish)
SSDB
Motif
Pfam: UNC-93
Other DBs
NCBI-GeneID: 100000934
NCBI-ProteinID: NP_001275745
ZFIN: ZDB-GENE-130424-1
Ensembl: ENSDARG00000069114
Vega: OTTDARG00000034324
UniProt: F1QYA8
Position
1
AA seq 623 aa
MAALIADDNVYREAELDGAPPAEAEDPPQLPGPEGNIQGQVEEFLGPHPDYDEEEEERKY
YRRKRLGVVKNVVGASCGGMIIYSVYMGLLQMQLILHYDETYREVKYGTLGLEDIDNKML
MGINVTPIVGLLYTPVLIRFLGTKWMMFLASGIYALFVSTNYWERYYTLVPSAVAIGVVI
VPLWASMGNYITRMAQQYYEFVNYKDENVQEQKKPPKGAFHSYIIIFQSVFYIIFHLSFV
FAEFPTVLFLNNYLNDYRHTLFKVSQCGAGGKGVIENFNKTVLKSLPRSLLLIEVESALM
GAAFLSMLIFLLLCGAAYRPTEEIDLRSIGWGNIFQLPFKHLRDYRIRLLCPFFIYSGFE
VLFAVQGLTLSYGVCAVGMEKLWLLVMVYGLSSSICSALALALLRLPRPVILLAGAFVHF
VLIIALMCWSPTPRDTSRLPYLLVVSALWGLGTALNKTGLSTLLGMLYEDKERLDFVYTI
YHWWQAIAIFIVYLWSALPMRAKLGLLLLTLLVASLCYVQMERRLAKKIPFRLPRIPRPR
HKVKGYRYLEEENSDESDTDLSDADDDDDKEEDERMLVEEDRNTDGDSQGSPGPERKRVR
DRRRKHDNTAYEQAGERDDYVQH
NT seq 1872 nt   +upstreamnt  +downstreamnt
atggcagcactgatcgctgacgataacgtgtaccgcgaggcggagctagacggcgcgccc
cctgctgaagcagaggatccaccgcagctgcccggacctgagggaaacatacaaggacag
gtggaggagtttctcggcccacatccagactacgatgaggaggaggaggagcgcaagtac
tacaggcgaaagcggctgggtgtagtgaagaacgtggtgggggccagttgcggaggaatg
atcatctacagcgtctacatgggtttgttacagatgcagttgattctgcactacgatgag
acgtaccgagaggtcaagtacggcacattagggctggaggacatcgacaataaaatgctg
atggggatcaacgttacgcctatcgtcggcctgctctacacaccggtgctcattaggttt
ctgggcactaaatggatgatgtttctggcgtcaggcatctatgctctgtttgtttcaacc
aattactgggagcgatattacactcttgtgccatcagcggtggccatcggtgtcgtcatc
gttccactgtgggcttcaatgggaaactacatcactagaatggcccagcagtactacgag
tttgtgaattacaaggatgaaaatgtccaggagcagaaaaaacctcccaaaggagctttc
cattcctacatcatcatcttccagtccgtcttctacatcatttttcatctgagtttcgtg
tttgccgagttccccacggtgctgttcctcaataactatctgaatgattacagacatact
ctcttcaaagtctcacagtgtggagccggcggcaaaggagtgattgagaatttcaataag
acggttttgaagagtctgcctcgctctctgctgcttatcgaggtggagagtgcgctcatg
ggagcagcgtttctgtccatgctcatattcctgctgctgtgtggagctgcataccggccc
acagaagaaattgacctgcgcagcattggctggggaaacatcttccagctgcccttcaag
cacttacgagattaccgcatccgcctgctctgcccgttcttcatctactctggctttgaa
gtgctctttgccgtccagggcctcacactgtcatatggagtgtgtgcagtgggcatggag
aagctgtggctgttggttatggtgtacggtttgtcatcctccatctgttcggctcttgct
ttggcattgttgcgattgcccaggcccgttattctcctagcaggagcgtttgtgcacttc
gtgttgatcatcgctctgatgtgctggtcgcccactcctcgggacaccagccgtcttcct
tatctgctggtggtctctgcactttggggcctgggcactgcccttaacaaaaccggactg
agcactctgctggggatgctgtatgaggacaaggagcgactggactttgtttacaccatc
tatcattggtggcaagctattgccatcttcatcgtctacctctggtctgcattacctatg
cgggctaagctggggctgctgttgttgactctcctagtggcgtctctctgttacgtgcag
atggagcgacgtctggccaagaaaattcccttcaggttgccacgaatcccccgtcctcga
cacaaggtcaaaggttatcgatacctcgaggaagagaattctgatgaatccgacacagac
ctgagtgatgcagacgacgatgatgataaagaggaggacgagaggatgttggtggaggag
gacagaaatacagacggcgattcccagggatcaccgggaccagagaggaagcgggttcga
gaccgcaggaggaaacacgacaacactgcctacgagcaggccggagagagagatgactac
gtccaacactga

DBGET integrated database retrieval system