KEGG   Danio rerio (zebrafish): 100001113Help
Entry
100001113         CDS       T01004                                 

Gene name
mcoln3b
Definition
(RefSeq) mucolipin-3 isoform X1
  KO
K04994  mucolipin 3
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:dre04040]
    100001113 (mcoln3b)
Ion channels [BR:dre04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   100001113 (mcoln3b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PKD_channel
Motif
Other DBs
NCBI-GeneID: 100001113
NCBI-ProteinID: XP_021325744
ZFIN: ZDB-GENE-080225-25
Ensembl: ENSDARG00000102050
Position
23
AA seq 574 aa AA seqDB search
MDDSREDYLCINDPNGNWSECEAHVDPALEAFRRKLKYFFMNPCDKYKARQRKPWKLFLQ
IVKIAVVTVQLVSFGLSNQMVVQFKEENLLTFRHLFLKNYSESNTNTYAIYTQLDVYTHI
THIVQQFLMLPSITVGNHEYEQEGDVYTPLCICQQFYHNGSISPANETFDIDSRVDQECS
LIYPQDPFTESPLNFTLHFERLLSVTVNFTLKAINLETVEYHELPDCYVFNIMIQFDNKA
HSGRILVDLDNEVHIYECSDWSMTGASARNMYMMVLFDAVVILILSTSLLLCIRSVKAGV
LLQKEYSEFSLRRYRKCVSLSERLEFINGWYLLIIVSDVLTISGSVLKIVIQLKAVASYD
LCSILLGTGTMLVWIGVLRYMGYLKKYNSMLCVCCVVQILIITLRVALPNVIRFTCCAAM
IYLGYCFCGWIVLGPYHTKFRTLNTVSESLFSLINGDDMFATFKNMQQKSFVVWLFSRLY
LYTFVSLFIYMVLSLFITLITDTYDTIKHQQLDGEPVSDLQAFVLQCKDLPDSGEFSVEK
TNSISSTGGGKLMCCCSHRSSDSDEDTHFSECSS
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atggacgactcccgtgaggattacttgtgtataaatgaccccaacgggaactggtctgag
tgtgaggctcatgtggaccccgcgctggaggccttccggaggaaactcaagtacttcttc
atgaacccctgtgataaatataaagctcggcagaggaagccctggaaactcttcctgcag
atcgtcaagatcgccgtcgtcactgtacagctggtgtcgtttggtctgagtaatcagatg
gtggttcagtttaaggaggagaatctgctgacgttcaggcatctgttcctcaagaactac
agcgagagcaacacaaacacctacgccatctacacacagctggacgtctacacacacatc
acacacatcgtccagcagtttctgatgttgccgagtataacggtgggcaatcacgagtat
gagcaggaaggcgatgtttacactccgctctgcatctgccagcagttttaccacaacggc
agcatctcaccggccaacgaaaccttcgacatcgacagccgcgtggatcaagagtgttct
ctgatttacccgcaggatcctttcactgagagtccactgaacttcactctgcacttcgag
aggttattatcagtgacggtgaatttcactctgaaagccataaacctggagacggtggag
tatcacgagctgccggactgctacgtcttcaacattatgatccagtttgacaacaaggct
cacagcggcaggattctggtggatctggataatgaagtgcacatctatgagtgcagtgac
tggagcatgaccggagcctcagcgaggaacatgtacatgatggttctgtttgacgctgtg
gtgattctgatcctctccacatctttactgctctgcattcgctcagtgaaggccggagtc
ctgctgcagaaggaatacagcgagttctcgttgcggcgctacaggaagtgtgtgtctctg
tctgagcgtctggagttcattaacggctggtatctgctcatcatcgtcagtgatgttctg
accatcagcggatccgtgctgaagatcgtcatccagctgaaggcggtggcgagttatgat
ctctgcagtattctgcttggcaccggcactatgctggtctggattggggtcctgcgatac
atgggatacctaaagaaatacaactctatgttgtgtgtgtgttgtgttgttcagatcctc
atcattactctgcgagtggctctgccgaatgtgatccgcttcacctgctgcgctgcgatg
atctacctgggctactgtttctgcggctggatcgttctgggcccctaccacaccaagttc
cggactctgaacactgtgtctgaaagtctgttttcgctgatcaatggagatgacatgttc
gccacctttaagaacatgcagcagaagagttttgtggtttggctcttcagtcgtctgtat
ctctacacgtttgtgtctctgttcatctacatggtgctcagtctgttcatcacactcatc
acagacacctacgacaccatcaagcatcagcagctggatggagagccggtgtcggatctt
caggcgttcgtcctgcagtgtaaagatctgccagattctggagagttcagtgtggagaaa
accaacagcatcagcagcacaggaggaggaaaactgatgtgctgctgctcacacaggtcg
agtgactctgatgaagacacacacttctctgaatgctcctcttga

DBGET integrated database retrieval system