KEGG   Danio rerio (zebrafish): 100001530Help
Entry
100001530         CDS       T01004                                 

Gene name
oxtr
Definition
(RefSeq) oxytocin receptor
  KO
K04229  oxytocin receptor
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04020  Calcium signaling pathway
dre04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100001530 (oxtr)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100001530 (oxtr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:dre04030]
    100001530 (oxtr)
G protein-coupled receptors [BR:dre04030]
 Rhodopsin family
  Peptide
   Oxytocin
    100001530 (oxtr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 Gaa1
Motif
Other DBs
NCBI-GeneID: 100001530
NCBI-ProteinID: NP_001186299
ZFIN: ZDB-GENE-110805-2
Ensembl: ENSDARG00000033956
Vega: OTTDARG00000038422
UniProt: E4W699
Position
6
AA seq 388 aa AA seqDB search
MEDIFKDQDFWSFNESSRNATNETYGVNQTVNPLKRNEEVAKVEVTVLALVLFLALAGNL
CVLIAIHTAKHSQSRMYYFMKHLSIADLVVAVFQVLPQLIWDITFRFYGPDILCRLVKYL
QTVGMFASTYMLVLMSIDRCMAICQPLRSLHKRKDRCYVICSWALSLLFSIPQVYIFSLR
EVGSGVYDCWGDFVQPWGAKAYITWISLTIYIIPVTILSVCYGLISFKIWQNFKRKTKRD
QCITLTPKASKGNALARVSSVKLISKAKITTVKMTFVIVLAYIVCWTPFFSVQMWSAWDP
EAPREAMPFIISMLLASLNSCCNPWIYMFFAGHLFHDLKQNLFCCSTLYLKSSQCRYDPE
QDSRKSNSSTYVIKSTSSQRSITQTSIT
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggaggacatcttcaaggatcaagacttttggtcctttaatgagtcatccagaaacgcc
accaatgaaacctacggcgtgaaccagacggtgaatcccctcaagcggaacgaagaggtg
gccaaagtggaagttaccgtgttggccttggtgctgttcttggcgctcgccggtaacctt
tgcgtccttattgcaatccacacagccaagcacagccagtctcgcatgtattacttcatg
aagcacctcagcattgcagacctggtcgtggccgtcttccaggttcttcctcaactcatt
tgggacatcacttttcgcttttatggtccggacatcttgtgtaggttggtgaagtatctt
cagactgttgggatgttcgcctccacctacatgctggtgctgatgtccatagacagatgc
atggcgatctgccaacctcttcgttctttacacaagagaaaggaccgctgttacgtgatt
tgttcatgggcactgagcttacttttcagcatcccgcaggtttatatcttctccctacgg
gaggtgggttcaggagtctatgattgctggggagattttgttcagccttggggagcgaaa
gcctacattacgtggattagtctgacaatatacattataccagtgaccattctgagtgtc
tgctacgggctgataagctttaaaatatggcaaaactttaaaaggaagacgaagagggac
cagtgcatcactctcacacccaaagcatccaaaggcaacgcgctcgcgcgggtcagcagc
gtcaaactcatttccaaggccaaaatcaccaccgttaaaatgacttttgttatcgtactg
gcttacatagtgtgttggactccgtttttctccgtgcagatgtggtcagcatgggatcct
gaagcaccgagggaagcgatgccctttatcatctccatgttgctggccagtctgaacagc
tgctgcaacccctggatctacatgttttttgctggccatctcttccatgacctgaagcag
aatctgttttgctgctccacgctctatctgaagtcctctcaatgccgctatgatccagag
caagattcccgtaagagcaactcctccacctacgtcatcaaaagcaccagcagccagcgg
agcatcacccaaacctccatcacataa

DBGET integrated database retrieval system