KEGG   Danio rerio (zebrafish): 100001681
Entry
100001681         CDS       T01004                                 

Gene name
kcnd1
Definition
(RefSeq) potassium voltage-gated channel subfamily D member 1
  KO
K04891  potassium voltage-gated channel Shal-related subfamily D member 1
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:dre04040]
    100001681 (kcnd1)
Ion channels [BR:dre04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   100001681 (kcnd1)
SSDB
Motif
Pfam: Ion_trans DUF3399 BTB_2 Shal-type Ion_trans_2 BTB_3 PKD_channel
Other DBs
NCBI-GeneID: 100001681
NCBI-ProteinID: NP_001119942
ZFIN: ZDB-GENE-081105-40
Ensembl: ENSDARG00000074746
Vega: OTTDARG00000026306
UniProt: B0UYF4
Position
8
AA seq 632 aa
MAAGVATWLPFARAAAVGWLPLAKKTMPKPPIDKKNRNDEILFVNVSGLRFQTWKNTLDR
YPDTLLGSSEKEFFYNEDTQEYFFDRDPEMFRHILNFYRTGRLHYPRQECIQAFDEELAF
YGIVPDIIGDCCMEEYRDRKKENQERLAVDTEAEMATDTPLPPHSTHRERLWRAFENPHT
STMALVFYYVTGFFIAVSVIANVVETVPCRPLKGSKKDLPCGEKYSLAFFCMDTACVLIF
TFEYLMRLFAAPSRCKFMRSVMSVIDVVAIMPYYIGLVMPENEDVSGAFVTLRVFRVFRI
FKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGTKGTNFTSIPAS
FWYTIVTMTTLGYGDMVPNTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRAD
KMRAQQKVRLARIRLAKKGTTNAFLQYKEEGGFHDRDHDGALCLKNRSSFEHQHHHLLHC
LEKTTNHEFTDELTFSEMCMTESVGYRTSRSTSISSQQGVSTSCCPRRAKRRAIRLANST
VSVSRGSVQELDTLHVHKTTIRPQSRSSLNARTEDLKLNCDDRDFTAAIISIPTPPANTP
DESLPPSPAIPGILRNSRSSSFTHETVKISSL
NT seq 1899 nt   +upstreamnt  +downstreamnt
atggctgccggagtggcaacatggctaccgtttgccagggcagcagccgttggctggctt
cccctggccaagaaaaccatgcccaaaccaccaatagacaaaaaaaatcgcaacgatgag
atcctgtttgtaaatgtgagcggactccgcttccagacatggaaaaacacgctagaccga
tatcccgacactctgctgggcagctcggaaaaggagtttttctacaacgaggacactcag
gagtatttcttcgaccgggatccagagatgtttcgccacattttgaacttctaccgaaca
ggccggcttcactacccccggcaggagtgcattcaggccttcgacgaggagttggcgttc
tacggcatcgtgccggatattatcggagactgctgcatggaagagtacagggaccgcaag
aaagaaaaccaggagcgtttggcagtagacacggaggcggagatggcgacagacacccct
ctgccgccacacagcacgcatcgggaacgcttgtggcgtgcgttcgagaatccccacact
agcaccatggcactggttttctactacgtcaccggtttcttcatcgccgtctcagtcata
gcaaacgtagtagagaccgtcccatgccgaccgctcaaaggcagcaagaaagacttgcca
tgcggagagaagtactcgctggcgtttttctgcatggacacggcctgtgtgctcatcttc
accttcgagtacctcatgaggcttttcgccgcccctagccgctgcaagttcatgcgttca
gtcatgagcgtgattgatgtggtcgccatcatgccctactacatcggccttgtcatgcca
gagaacgaggacgtgagtggtgcgttcgtcacactaagggtgttcagagtcttccggatc
ttcaagttctcccgtcactctcagggcctgcggatcctgggttataccctgaagagctgt
gcgtctgagctgggcttcctgctgttttccctcaccatggctatcatcatatttgccacc
gtcatgttctacgctgagaaaggcaccaagggaaccaacttcaccagcatcccagcctcc
ttctggtacaccatagtcaccatgacaacgcttgggtatggagacatggtgccaaacacc
atcgctggaaagatctttggctctatctgctctctcagcggtgtgctggttattgctctt
cctgttcccgtcatcgtgtccaacttcagccgaatctaccatcagaatcaaagagcggac
aagatgcgagcccagcagaaagttcgacttgccagaattcgcttggccaagaagggaacc
accaacgccttcctacagtacaaagaagaaggaggatttcatgatcgggaccatgacggc
gctctgtgtctgaagaacagatcttcatttgagcaccaacatcatcatttgctccactgt
ctggaaaagacaacaaatcatgagttcactgatgagctgacattcagtgagatgtgcatg
acggagtctgtgggttaccgcaccagccgcagcacctccatctccagccagcagggggtt
tccacgtcctgctgcccgcgcagagccaagagaagagccatccgcctggccaactccact
gtatcagtgagccgcggcagtgtccaggagctcgacacactgcacgtgcacaagactact
atcagaccacagagccgctccagtctgaacgcgcggacagaagacctgaagctaaactgt
gatgaccgggatttcacagcggctataatcagtataccaacccctcctgccaacacccct
gacgagagtctgccgccctctcctgccattcccggcatcttacgcaactctcgttccagt
tccttcacccacgagacagtgaagatctcctccttataa

DBGET integrated database retrieval system