KEGG   Danio rerio (zebrafish): 100003238
Entry
100003238         CDS       T01004                                 

Symbol
si:dkey-210j14.3
Name
(RefSeq) zinc finger protein 382-like isoform X1
Organism
dre  Danio rerio (zebrafish)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 zf-met zf-C2H2_jaz zf-LYAR zf-C2H2_2 Leu_zip Zn-ribbon_8 zf-Di19 Csm1_N IFP_35_N Cnn_1N zf-C2HE Rho_Binding Elf1
Other DBs
NCBI-GeneID: 100003238
NCBI-ProteinID: XP_001342850
ZFIN: ZDB-GENE-131121-88
Ensembl: ENSDARG00000089883
Vega: OTTDARG00000037713
UniProt: E7EY17
Position
3
AA seq 350 aa
MNVMNTADFQTQLTSILEMLAKSAVVEISKLFEENSLLLRLEISRCTNENESLKKKCHFL
ESELQSARKTAAKMNGTEAPFSRTGLTGSARRPSIDNAFSKEWCMNLWRHEESNAGEQEE
SHQDSSGMAEDPVSLLDDEEDEEPDMIMIKEETFDDCSGKNKPDEDEMSSLAGPAMPSDG
RSQNCEDYITYTVPSDEQARPNVQQPQPEEESLHGTISTHGHNTAEQNFPSTHNPTSFSE
EKRFECVFCQRTFNKLTYLKAHMRTHSGEKPFVCTVCGKRFAQKTYLRIHQRTHSGERPY
SCMECGKSFAQKSSLNVHLRSHTGEKPYSCSECGKSYAYKQGFNTHQCFS
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgaacgtcatgaatacagctgattttcagacgcagttaacatccatactggaaatgtta
gcgaaaagcgccgttgttgaaataagcaaactattcgaggagaattcattgttgctgcgg
ttggagatttcacgatgtacaaacgaaaatgaatctctgaaaaagaaatgccattttctg
gagagcgaacttcagtctgctcgaaaaaccgctgcaaagatgaacgggacagaagctccg
ttcagccgcacgggacttacagggtctgcccgacgcccttccatcgacaatgcgttcagt
aaggaatggtgcatgaacctctggagacacgaggagtcaaatgctggagagcaggaggaa
tcacatcaggactcttcgggcatggctgaagatccagtaagtttgctggatgatgaagag
gatgaggagccagatatgatcatgatcaaggaggagacgtttgacgattgctctggaaag
aataaacctgatgaagacgaaatgagcagtttggcaggaccagcaatgcccagtgatggg
agatcacagaactgtgaagattacataacatacactgtgccttcagatgaacaagcccga
ccgaacgtacagcagccacaaccagaagaggaaagtcttcacgggacgatttctacacat
ggacacaacacagcagagcaaaatttccccagcacacacaaccccacgagtttttcagaa
gagaaaaggtttgagtgtgtgttttgtcaaagaactttcaacaaactaacctacctaaaa
gcacacatgcgaacacactctggagaaaagccttttgtctgtactgtgtgtggtaaaaga
tttgcgcaaaaaacgtacctccgaatacaccagcgcactcactccggtgaaaggccgtac
tcgtgcatggagtgcggaaagagttttgcccaaaaaagctctctaaacgtgcatctccga
agccacactggagaaaagccgtacagctgctcagagtgcggtaaaagctacgcgtacaaa
cagggtttcaatacacaccagtgctttagttag

DBGET integrated database retrieval system