KEGG   Danio rerio (zebrafish): 100003562Help
Entry
100003562         CDS       T01004                                 

Gene name
ecd
Definition
(RefSeq) protein ecdysoneless homolog
Organism
dre  Danio rerio (zebrafish)
SSDB OrthologParalogGFIT
Motif
Pfam: SGT1 Sigma70_ner
Motif
Other DBs
NCBI-GeneID: 100003562
NCBI-ProteinID: NP_956185
ZFIN: ZDB-GENE-030131-6304
Ensembl: ENSDARG00000022944
Vega: OTTDARG00000020329
UniProt: Q7SXQ4
Position
17
AA seq 630 aa AA seqDB search
MDILKRPGIPEDAVQYKLFVVAADPSAPEKSLQQILQDILAEITPLLVPYIWQHQPFNLT
QHPGKGDVPAHLGGVTEFGDNVEDEWFIVYLLKHITHTFTDIAGVVYDNDGQFLLIEAAE
HLPKWLDPDSSENRVFLYHGELHIIPMSSSSGEVGFSRDCVPTVRQALEVLRLHTDRCLA
KQTIRSALNQRIHGYPDKIQQNVHRAHCYVPAGIAVVLSRRPDLIAPAVSAFYLRDPVDL
QACRTFHTFPPDTRVMTSVKFTRCLYAQLQQQSFVPDRRSGFSLPARSHPQYRAHELGMK
LAHGFEILCSKNGESSSDQEPSVSSNPLWRGFLESLKKNGYFKGNLEGSARYKELMTSAE
SFFRQSVTRTHRPDIHNPGGEVLKVLQSASYSLEDLQKQEANLPPEDSDAWLDISPQELE
RLLAERGGRGGTGEEVQEEESGYSLIAVTQGMKNFINAMSSHEGAEIPRSCLAEPFRFDP
DSVTSALDRLLGAKDDELDSDDFEDEDDDDDDDDDEAVQSSVPQEQATGAETLDNLRKYM
DEMDQELQSTNIGKSFTQNNRSSNKAEASKSSSSTSASELLEDEIQPLDVDLNLVTNLLE
SLSSQAGLAGPASNLLQSLGLHIPPDADQP
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atggatattctgaaaagacctggcatccctgaagacgctgtgcagtataagctgtttgtg
gtcgctgctgacccctcagccccggagaaaagcctccagcagatcctgcaggacatcctc
gctgagatcacccctctccttgtgccctacatctggcaacatcagcccttcaatctcaca
cagcacccggggaaaggggatgtgcctgcacatctgggaggtgttactgagttcggtgat
aatgtggaggacgaatggttcatcgtttacctgctcaaacacatcacacacacctttact
gacatagctggtgttgtctatgacaatgacggacagtttctactgattgaagctgctgaa
cacctgccaaagtggctggaccctgacagcagtgaaaacagggtatttctgtatcatgga
gagctgcacataatacccatgagcagttcttctggagaggtgggcttttcaagagattgc
gtgcccactgtacgtcaggctctagaggtgctgcgcttacacactgaccgatgtttggcc
aaacagaccatacgatctgctctgaaccagaggattcatgggtatccagataaaatccag
cagaatgtccaccgtgcccactgttatgtgcctgcaggcattgctgtggtgttgtccagg
aggcctgatcttatagcccctgccgtgtctgctttctatctgcgtgaccctgttgatctc
caagcttgccgaactttccacacctttccccctgacaccagagtcatgacgtcggtaaag
tttactcgatgcttgtatgcacagctgcaacaacagagttttgttccagaccggcggagt
ggtttcagtcttcccgctcgctctcatccccagtacagggctcacgagctgggtatgaaa
ctggcccatggctttgaaatcttgtgctccaaaaatggagagtcttcatcagatcaagag
ccttcagtgagcagcaacccattatggagaggatttttagagagcctcaaaaagaatgga
tactttaaggggaatctagaaggatctgctcgatacaaagagctgatgacatcagcggag
agtttcttcagacagtcagtgacaagaactcaccggcctgatattcataatcctggcggt
gaggtgttaaaggtgttacaaagcgcctcctacagtctagaagacctacaaaaacaagaa
gcaaatctgccaccagaggacagtgatgcgtggctggacatctcgcctcaggagctggag
aggctgctggcagagcgaggaggtcgaggagggactggtgaagaggtgcaggaggaggaa
tcgggatacagtctgatcgctgtgactcaaggcatgaagaacttcatcaatgccatgtcc
tcgcatgaaggagctgaaataccaagatcctgcttggctgagccttttaggtttgatcca
gattcagttactagtgcccttgatagacttctgggagctaaagatgatgagctagactct
gatgactttgaagatgaagatgatgacgacgatgatgatgacgatgaagcagtgcagagc
agtgtccctcaggagcaggcaaccggtgcagagacattggacaatctcaggaaatacatg
gatgaaatggaccaggagctgcaaagcacaaacattggcaaaagctttacccagaacaac
agatccagcaataaagctgaggcatctaaaagctcatcttccacctcggcctcagagctg
cttgaggatgaaatccagccgcttgatgtggatctcaacctggttaccaatctactagag
tctctgtcctctcaggcgggtctggccggtccagcatcaaacctactgcagagtctaggt
cttcacatcccacctgacgcagatcagccctga

DBGET integrated database retrieval system