KEGG   Danio rerio (zebrafish): 100004228
Entry
100004228         CDS       T01004                                 

Gene name
slc27a2b
Definition
(RefSeq) very long-chain acyl-CoA synthetase precursor
  KO
K08746  solute carrier family 27 (fatty acid transporter), member 2 [EC:6.2.1.- 6.2.1.3]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre03320  PPAR signaling pathway
dre04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:dre00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100004228 (slc27a2b)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    100004228 (slc27a2b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:dre01004]
    100004228 (slc27a2b)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dre02000]
    100004228 (slc27a2b)
Enzymes [BR:dre01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     100004228 (slc27a2b)
    6.2.1.-  
     100004228 (slc27a2b)
Lipid biosynthesis proteins [BR:dre01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   100004228 (slc27a2b)
Transporters [BR:dre02000]
 Solute carrier family (SLC)
  SLC27: Fatty acid transporter
   100004228 (slc27a2b)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 100004228
NCBI-ProteinID: NP_001373573
ZFIN: ZDB-GENE-081104-49
Ensembl: ENSDARG00000100731
Vega: OTTDARG00000027974
Position
25
AA seq 616 aa
MFWYTVSAVILLIALRLKCPYIISQTKYMCRVALAVYRTTKYIKSKPFYTILDRFQDSVR
KNPKKAFIRFLDQTYSYEQSDKESNKIARTLLKHADLHEGDTVALLLGNEPMFLWIWLGL
AKIGCSVALLNHNIRSKSLLHCFTCCGANVLIAGADLQDAVEEVLPALREQGISIYILTE
HVSSEGMTSLTDKIKQASDQPIPTDLRANVAFNTPAAYIYTSGTTGLPKAAVITHRRLWA
MAFFQSICGVKSDDVIYVCLPLYHSSGFGLGFGGSVERGATIVLRSKFSSSQFWDDCRKY
NVTVIQYIGETMRYLCNMPKCVSDQVHNVRMAIGNGIRPDIWRTFINRFGHVEIKEFYGS
TEGTLGFLNYAGKIGAVGTVNSFHKKLYPYVFIKFDHEKEEPVRNADGFCIEVAKGETGL
LVTRLTQKIEFSGYARDPKQTEKKKLHDVFEKGDVYFNTGDLFRTDRENFIYFQDRVGDT
FRWKGENVSTNEVSDIMTLVPCIEEANVYGVTVPGFEGRIGMAAIILKKDHQFECDDVFN
HVTSYLPVYARPRFIRIQSSLAVTCTFKQLKGRLVEEGFNPALITDPLFILDETVKSYRP
LTHDTYESILDARFRL
NT seq 1851 nt   +upstreamnt  +downstreamnt
atgttttggtatactgtaagcgctgtgatacttttaatagcattgagactcaaatgtcct
tacattatctcacagaccaagtacatgtgtcgagtggcattagccgtgtaccgcacgaca
aagtacatcaaatccaagcctttttacacgatactggatcgattccaggattcggttcgg
aagaacccgaaaaaagcgttcattcggtttctggatcaaacttactcatacgagcagtcg
gataaagagagcaacaaaatcgcgaggactttgctgaagcacgcggatcttcatgaagga
gacacggttgcgcttttgctcgggaatgagcccatgtttctgtggatatggttgggttta
gctaagatcggatgttctgttgctcttctcaatcataacatccgatccaagtcccttctg
cactgcttcacctgctgtggggccaatgtgctgatagccggtgcagatctgcaagatgcg
gtcgaggaggtgctgccggctctgagagagcaggggatctctatatatatactaactgag
catgtgagctcagagggaatgacgagtctcacagacaagatcaagcaggcctcagatcag
cccattccaacagaccttagggccaatgtggccttcaacaccccagcggcctacatctac
acttcaggaaccaccggtctcccgaaggcggcagtgatcactcaccgcaggctctgggcg
atggccttctttcagtccatctgtggagtgaagtctgatgacgtgatttacgtctgcctg
cctttgtatcacagctctggctttggcctcgggttcggaggttctgttgaacgaggagcc
acgattgtcctgaggagcaagttttcttcctctcagttctgggacgactgcagaaagtat
aacgtcactgtgattcagtatattggagaaaccatgcgctacctctgcaacatgccaaag
tgtgttagtgaccaagtgcacaacgtcaggatggccattgggaatggcatccggccggat
atctggaggacgttcataaacagattcggtcatgttgaaatcaaagaattttacggctca
actgaaggaactctgggcttcttgaactacgctggcaaaattggggccgtcggtactgtc
aattcttttcataagaaactgtacccgtatgtcttcatcaagtttgatcatgagaaagag
gagcccgtcagaaacgctgatggattttgtattgaagttgcaaagggagagacgggtctg
ctagtgacacggctcactcagaagattgagttttctggatacgcccgggatcccaaacag
acggagaagaagaaactccatgatgtgtttgagaagggagacgtttacttcaacactgga
gatctgttcaggactgaccgagaaaacttcatctacttccaggatcgggtgggcgacact
tttagatggaaaggggaaaacgtctccactaatgaagtgtcagacatcatgactctggtg
ccttgtatcgaggaagcaaatgtttacggcgtcacagttccaggttttgaggggaggata
ggaatggccgccatcatactgaagaaagaccatcagtttgagtgtgatgacgttttcaat
cacgtgacctcctaccttccggtttacgccagaccacgtttcatacgcatccagagcagt
ttggctgttacctgcaccttcaagcaactgaaggggaggctggtggaggaaggctttaac
cccgctctcatcactgacccgctgtttatcttagacgagacggtgaagagctacagacct
ttgacacatgacacatatgaatccatactggacgctcgattcagactgtga

DBGET integrated database retrieval system