KEGG   Danio rerio (zebrafish): 100005717Help
Entry
100005717         CDS       T01004                                 

Gene name
cpt2
Definition
(RefSeq) carnitine O-palmitoyltransferase 2, mitochondrial
  KO
K08766  carnitine O-palmitoyltransferase 2 [EC:2.3.1.21]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00071  Fatty acid degradation
dre01212  Fatty acid metabolism
dre03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100005717 (cpt2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    100005717 (cpt2)
Enzymes [BR:dre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     100005717 (cpt2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf DUF3077
Motif
Other DBs
NCBI-GeneID: 100005717
NCBI-ProteinID: NP_001007448
ZFIN: ZDB-GENE-030131-6719
Ensembl: ENSDARG00000038618
Vega: OTTDARG00000020585
UniProt: Q5U3U3 B2GQ15
Position
8
AA seq 668 aa AA seqDB search
MAGLLSTQCNSTLSKLKHLSNNPALSVLTSTHRKYSSKDGAGSEYLHKSIVPSMHYQKSL
PRLPVPKLEDTIRRYLAAQRPLLNDEQYSNTEKLAQEFQSGAGKQLHEELVALDKKNKHT
SYISAPWFDMYLSARESIVLNFNPFMSFNPDPKPEYNDQLVRATNMVCSAVRFMKTLRAG
LLEPEVFHLNPAKSDTDSFKKLIRWVPPSISWFGAYMVNAYPLDMSQYFRLFNSTRIPKY
KRDELLTDDRGRHLLVMKRGNLYVFDALDRDGNLIKPAEVQAHLKYILEDPTQASAFPLG
VLTSENRDTWTGLRQKLLDAGNGEALQLVDTALFCLCLDEEVLRDHIHISHNMLHGDGCN
RWYDKSFSVILAKDGQAAINFEHSWGDGVAVLRFQNEVFKDTTEKPLVGPGSQPASVDSS
SAVRRLEFKLNDELKAGITKAKENFQAAVSKLTIDAMEFKKGGKEQLKKKKLSPDAIAQL
AFQMGFLRQYGQTVATYESCSTAAFKHGRTETIRPASIHTKQCAKAFVQQPGQHSVEQLL
GLLNECSKYHGQLTREAAMGQGFDRHLFAMRYLANSKGMALPSLYQDPAYAAINHNILST
STLTSPAVSLGGFAPVVPDGFGVGYGVHDEWIGCNVSSYPARDVHEFLRCVHKSLEDIFT
VLDGNPIH
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atggcaggtttgctttctacgcaatgcaactcaacgctgagtaaattaaaacacttgagc
aataaccctgccctgtcagttttaacgagcactcatcgtaaatacagcagtaaggatgga
gcaggatctgagtatttgcacaagagtatcgtcccgagcatgcactaccagaagagttta
cccagattaccagttccaaaattggaggatacaatacggaggtatttggcagctcaaaga
ccactgctgaatgatgagcagtacagtaacacagaaaaattagcacaagagtttcagagt
ggtgctggcaagcagttacatgaagaacttgtagccttggacaagaaaaacaaacacacc
agctacatatcagctccatggtttgacatgtacttgtctgctcgggagtctatagtgctt
aactttaaccccttcatgtcctttaaccctgaccccaaacccgaatacaatgaccagctt
gttcgggccaccaacatggtgtgctcagcggtccgcttcatgaagacgcttcgtgccggt
ttactggagccagaggtgtttcaccttaaccctgccaaaagtgacacagatagtttcaag
aagctcattcgatgggtgccgccctccatatcgtggtttggagcctacatggtgaacgcc
tatcctctggatatgtcccagtactttcgcctcttcaactcaacacgtataccaaaatac
aagagggatgagctcctcacagatgacaggggcaggcacctgctcgtaatgaagcgagga
aacctgtatgtgtttgatgctcttgatcgagacggcaacctgatcaagcctgctgaggtt
caagctcaccttaaatacatactagaagatccaacacaagcttctgcgttccccttaggt
gtcctaactagtgagaatagagacacctggacagggttgagacaaaaactacttgatgct
ggaaatggtgaagctctgcagttagtggacactgctttgttttgcctgtgcttggatgag
gaggtgctgagagaccacatccacatctcccacaacatgctgcatggtgacggctgcaac
cgctggtacgacaagtccttcagtgtcatcttggctaaggatggacaggcagctataaac
ttcgagcactcttggggtgatggtgtggctgtcctgcgtttccagaatgaggtcttcaag
gacaccacggagaagcctctggttgggccgggttctcagcctgcgtccgtagactcatct
tcagcggtgcgccgtttagagttcaagcttaatgacgagttaaaagctggaatcacaaaa
gccaaagaaaatttccaggctgccgtatcaaagctcaccatagatgcaatggagttcaag
aaaggtggaaaggagcagcttaagaagaagaagctcagcccggacgccatcgcacagctt
gctttccagatgggcttcctgaggcaatacggccagacggtcgccacttatgagtcctgc
agcactgcagcctttaaacacggccgcactgaaaccatccgtcctgctagcatccacact
aagcagtgtgcaaaagccttcgtccagcagccgggacagcacagtgtggagcagttactg
ggactgctgaatgaatgctctaaataccacgggcaactcactagagaggcggccatgggt
caaggtttcgatcgccatcttttcgccatgcgctacttggctaattcgaaaggaatggca
ctgcccagtctgtaccaggatcctgcatatgcggccataaaccacaacatcctgtctacc
agtactctgactagccctgcggtcagtctgggtggctttgctcctgtggtgcctgatggt
tttggagtgggttatggggttcatgatgaatggattgggtgcaacgtgtccagctaccct
gccagagatgttcatgagttccttaggtgtgttcacaagtccttggaagacatttttaca
gtccttgatggaaaccccattcattga

DBGET integrated database retrieval system