KEGG   Danio rerio (zebrafish): 100006266
Entry
100006266         CDS       T01004                                 

Symbol
si:dkeyp-53d3.6
Name
(RefSeq) uncharacterized protein LOC100006266
Organism
dre  Danio rerio (zebrafish)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_jaz zf-C2H2_6 Zn-ribbon_8 zinc_ribbon_15 zf_UBZ Zn_ribbon_SprT zf-LYAR zf-C2H2_11 zf-met Ribosomal_S4e DUF6300 HypA
Other DBs
NCBI-GeneID: 100006266
NCBI-ProteinID: NP_001076526
ZFIN: ZDB-LINCRNAG-050208-390
Ensembl: ENSDARG00000111659
UniProt: A0A2R8QMU3
Position
22:1427985..1433511
AA seq 288 aa
MDENEELADVEGTKQHVENDNQPEPRNEKSFACPQCEKTFKFKHHLRIHLRVHTGEKPYA
CEFCGHRFKYERSFQEHRRIHTGEKPYRCVHCGKTFAYKNTYKIHTRIHTGEQPYMCNQC
EKSFTHARSLHAHLRTHSGEKPFPCEQCGKTFATAFAVRKHVKIHLKEKPYICTLCGKGF
TEAGSLNIHQKRHIGVKDHICSECGKSFITSSELKVHQKFHNGEKPHKCSFCEKSFCQSG
ALKAHETSHTGEKPYHCSECQKRFSQFSSLRRHRMKKIACKNPHEQIL
NT seq 867 nt   +upstreamnt  +downstreamnt
atggatgaaaacgaagaactggccgatgtggaggggacaaaacagcatgttgaaaatgac
aatcaaccagagccgagaaacgaaaagtcattcgcgtgccctcaatgtgagaagaccttc
aaatttaaacaccatcttcgaatccacctgagagttcacaccggggagaagccgtacgct
tgcgaattttgcggacatcgtttcaaatacgagaggagtttccaggagcaccggcgaatc
cacacgggggagaaaccgtatcggtgcgtccactgcgggaagacgtttgcttataaaaac
acgtataagatccacacgaggatccacaccggcgaacaaccgtacatgtgcaaccagtgc
gagaagagcttcacgcatgcccgatctctgcacgcgcacctgcgcactcattcaggagaa
aaaccgtttccgtgtgagcaatgcgggaaaacattcgccaccgcgttcgctgtgaggaag
cacgtcaagattcatctaaaggagaaaccctacatttgtacgctgtgcgggaagggcttc
acggaggccggctctctgaacattcaccagaaaagacacatcggcgttaaggatcacata
tgcagcgagtgcgggaagtccttcatcaccagcagcgagctgaaagtgcaccagaagttc
cacaacggcgagaaaccgcacaagtgttcgttctgcgagaagagcttctgccagtcggga
gcgctgaaagcacacgagacgtctcacaccggagagaaaccgtatcactgcagcgagtgc
cagaagaggttcagtcagttcagctcactgcgcagacaccgaatgaaaaaaatcgcctgt
aaaaacccacacgaacaaatactatag

DBGET integrated database retrieval system