KEGG   Danio rerio (zebrafish): 100034405
Entry
100034405         CDS       T01004                                 

Gene name
capn3b
Definition
(RefSeq) calpain-3b
Organism
dre  Danio rerio (zebrafish)
SSDB
Motif
Pfam: Peptidase_C2 Calpain_III EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_7 EF-hand_5 AvrB_AvrC
Other DBs
NCBI-GeneID: 100034405
NCBI-ProteinID: NP_001230250
ZFIN: ZDB-GENE-041001-149
Ensembl: ENSDARG00000043035
Vega: OTTDARG00000005453
UniProt: E9QE31
Position
20
AA seq 723 aa
MAEEQKFSETSVQLTEAAPQTVGSGFTAPGNIYSAILSRNEAVKDARRLKDFQELRDKYV
RKKVLFEDPLFPAQDSSLFYSEKFPLKLEWKRPMEICKNPQFILGGANRTDICQGDLGDC
WLLAAIACLTLNDVILKRVVPHDQSFTENYAGIFHFQFWRYGEWVDVVIDDRLPTYKNKL
VFTRSGQNNEFWSALMEKAYAKLHGSYEALKGGNSLEAMEDFTGGVTEFYEITEAPKELY
NIMRKALKRGSLMGCAIDTLVPTAQRTKTASGLVRGHAYSVTGVEQGKRKDGKDLMIRLV
RVRDPWGVAPPPACKSNDWVELAKTEQDKQRLQPGEQGEFWMCFEEFQKNFTKLEICNLT
PDTLEDDQMFKWNVTVHEGRWVKGCSAGGCRNFPDTYWTNPQFRLVLLEADAKEKTCTVV
VALMQKGRRVERCSGATLHNIGFAIYEVPKEMKGNQQQQLSKDFFLYNASTARSKSYVNI
REVTERFCLKPGEYVIIPSTFDPHKESEFLLRVFSENRSTSKVIDAEIEAEPMQVDNVKK
KIKPFEEEETEEEKQFRAIFQQIAGDDMEINANELRTVLNRVVAKHKELKTEGFSLESCR
SMIALLDTDGTGHLNLQEFKHLWNKIKQWKLVFTRFDTDKSSTISSFEMRNALTEAGFQL
NNQLYDIICMRYANEHMELDFDSYISCLVRLEGMFRAFRAFDKDGDGLIKLNVFEWLQLT
MYA
NT seq 2172 nt   +upstreamnt  +downstreamnt
atggcagaagaacagaagttttcagaaacatctgtccaactcactgaagctgctccgcag
acagtgggcagtggttttacagcccctggaaacatttattcagccattttgagccgtaat
gaggctgttaaagatgccaggaggctcaaggactttcaagagcttagagataaatatgta
cgcaagaaagtgctgtttgaagaccccctgttcccagctcaggactcctctctcttttac
agtgaaaagttccccttaaagcttgaatggaagcgtccaatggaaatttgtaaaaatcca
cagttcattcttggaggagccaataggactgacatctgccaaggagacctgggagactgt
tggctgttggctgccatagcttgcctgaccctgaatgatgtcatcctgaagagggttgtt
cctcatgaccaaagcttcactgaaaactatgctggcattttccatttccagttttggcgc
tatggtgagtgggtggatgtggttattgacgatcgacttcccacatacaaaaacaagctg
gtctttaccaggtctggacagaataatgaattttggagtgctctcatggaaaaggcatat
gcaaagttacatggctcttatgaagccttaaagggagggaactcattggaggctatggag
gacttcactggaggtgtaactgagttctatgagattacagaagccccgaaagagttgtac
aacatcatgaggaaggctctgaagagaggatccctcatgggctgtgccatagacactttg
gttccaactgctcaaaggactaaaactgcatctggacttgtgcgaggccatgcatattca
gtcactggagttgagcagggtaaacgaaaggatggtaaagacctaatgattcgtctggtt
cgtgtgcgagacccctggggtgttgccccccctcctgcctgtaaatctaatgactgggtt
gaactcgccaaaaccgaacaagacaagcagagactacagcctggagagcaaggggagttc
tggatgtgctttgaggagtttcagaagaacttcaccaaactggagatctgcaatcttact
ccagacactcttgaggatgaccagatgttcaagtggaatgtaactgtacatgagggccga
tgggtgaaaggttgttctgctggtggctgcagaaactttccagacacatactggacaaac
cctcaattccgtctggttcttctggaggcggatgctaaagagaagacctgcacagtggtg
gtggcactaatgcaaaagggcaggagagtagagcgctgctctggtgcaacccttcacaac
attgggtttgccatctacgaggttcctaaggagatgaagggcaaccaacaacaacagctg
tcgaaggatttcttcctttataatgcctccacagctcgctccaagtcttacgtcaacata
cgtgaggtgacggagcgattctgcctgaaaccaggcgagtatgtcatcattccatccacc
ttcgatccccacaaggagagcgagtttctgctcagagtcttctctgagaacagaagcacc
tcaaaagttatagatgcagagattgaagcggagcccatgcaggtagataacgtcaagaaa
aaaatcaagccatttgaggaagaggagactgaagaggaaaaacagttcagggccatcttt
cagcagatagctggagacgatatggagattaatgccaatgagctcaggactgtcctaaac
agagtggttgccaaacataaagagctaaaaacagagggcttcagtctggaaagttgcaga
agtatgatcgcactcctggatactgatggaacaggtcatctaaacctgcaggagttcaaa
cacttatggaacaagattaaacagtggaagctggtgttcacacgtttcgacactgacaaa
tccagcacaatcagcagtttcgagatgaggaacgcacttactgaagcaggttttcaactc
aacaatcagctgtatgacatcatttgtatgagatatgccaatgaacacatggagttggat
ttcgacagctacattagctgcttagtgcgactggagggaatgtttagggcgttcagagcc
tttgacaaggatggtgatggacttatcaagctcaatgtttttgagtggcttcaactgaca
atgtacgcctaa

DBGET integrated database retrieval system