KEGG   Danio rerio (zebrafish): 100126123Help
Entry
100126123         CDS       T01004                                 

Gene name
hsp70.1
Definition
(RefSeq) heat shock cognate 70-kd protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
dre  Danio rerio (zebrafish)
Pathway
dre03040  Spliceosome
dre04010  MAPK signaling pathway
dre04141  Protein processing in endoplasmic reticulum
dre04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100126123 (hsp70.1)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100126123 (hsp70.1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100126123 (hsp70.1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100126123 (hsp70.1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dre01009]
    100126123 (hsp70.1)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dre03041]
    100126123 (hsp70.1)
   03009 Ribosome biogenesis [BR:dre03009]
    100126123 (hsp70.1)
   03110 Chaperones and folding catalysts [BR:dre03110]
    100126123 (hsp70.1)
   04131 Membrane trafficking [BR:dre04131]
    100126123 (hsp70.1)
   03051 Proteasome [BR:dre03051]
    100126123 (hsp70.1)
   03029 Mitochondrial biogenesis [BR:dre03029]
    100126123 (hsp70.1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dre04147]
    100126123 (hsp70.1)
Protein phosphatases and associated proteins [BR:dre01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100126123 (hsp70.1)
Spliceosome [BR:dre03041]
 Complex B
  Other components
   Prp19 complex
    100126123 (hsp70.1)
 Complex C
   Prp19-CDC5 complex
    100126123 (hsp70.1)
Ribosome biogenesis [BR:dre03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    100126123 (hsp70.1)
Chaperones and folding catalysts [BR:dre03110]
 Heat shock proteins
  HSP70 / DNAK
   100126123 (hsp70.1)
Membrane trafficking [BR:dre04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    100126123 (hsp70.1)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    100126123 (hsp70.1)
Proteasome [BR:dre03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    100126123 (hsp70.1)
Mitochondrial biogenesis [BR:dre03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    100126123 (hsp70.1)
Exosome [BR:dre04147]
 Exosomal proteins
  Proteins found in most exosomes
   100126123 (hsp70.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C MetOD2
Motif
Other DBs
NCBI-GeneID: 100126123
NCBI-ProteinID: NP_001349288
ZFIN: ZDB-GENE-990415-91
Ensembl: ENSDARG00000029688 ENSDARG00000092362
Position
3
AA seq 643 aa AA seqDB search
MSSPKGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ
VAMNPNNTVFDAKRLIGRRFDDPVVQSDMKHWSFKVVSDGGKPKVAVEHKGENKTFNPEE
ISSMVLVKMKEIAEAYLGQKVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTA
AAIAYGLDKGKSSERNVLIFDLGGGTFDVSILTIEDGIFEVKATAGDTHLGGEDFDNRMV
NHFVEEFKRKHKKDISQNKRALRRLRTACERAKRTLSSSSQASIEIDSLYEGIDFYTSIT
RARFEELCSDLFRGTLDPVEKALKDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDFFNGRE
LNKSINPDEAVAYGAAVQAAILMGDTSGNVQDLLLLDVAPLSLGIETAGGVMTALIKRNT
TIPTKQTQTFTTYSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTF
DIDANGILNVSAADKSTGKQNKITITNDKGRLSKEEIERMVQEADKYKAEDDLQREKISA
KNSLESYAFNMKNSVEDDNLKGKISEEDKKRVIEKCNEAVSWLENNQLADKEEYEHQLKE
LEKVCNPVISKLYQGGMPAGGCGAQARGASGASAQGPTIEEVD
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctccaaaaggaatcgctattggcattgacctgggcaccacctactcctgtgtg
ggggtgtttcagcatggaaaagtggagatcatcgccaacgaccagggcaacagaacaaca
cccagctatgtggccttcacagacacagagaggctgattggagacgcagctaagaaccag
gtggccatgaatcccaacaacacggtgttcgatgccaagaggctgatcggcaggaggttc
gatgaccctgtagtgcagtctgacatgaagcactggtccttcaaagtcgtcagtgatgga
ggaaagccaaaagttgcagtggaacacaaaggagaaaacaagacctttaatcctgaagag
atttcctccatggtcctggtgaagatgaaggagattgcagaggcttatctggggcagaag
gtgaccaacgcagttatcacagttccagcctatttcaacgactcccagagacaggccact
aaagatgctggagtcatcgctggactgaacgtgctccgcatcatcaacgagcccacggct
gcagccatcgcctacggcctggacaaaggcaaatcctcagagcgcaacgtgctgatcttt
gacctgggtggaggcaccttcgacgtgtccatcctgaccattgaagacggcatctttgag
gtgaaggccaccgctggagacactcatctgggcggtgaggactttgacaaccgcatggtg
aaccactttgtggaagagttcaagaggaagcacaagaaggacatcagtcagaacaagagg
gccctgaggaggctgcgaaccgcatgcgaacgagccaagaggacgctctcgtccagctct
caggccagcattgagatcgactctctgtacgagggcatcgacttctacacgtccatcacc
agagctcgcttcgaggagctctgctccgacctcttcaggggaacgcttgatcctgtggag
aaagcactgaaggacgccaagatggacaaggctcagatccacgacatcgtgctggttggg
ggatcaacaagaatcccaaagatccagaagcttctgcaggatttcttcaacggcagagaa
ttgaacaagagcattaaccctgatgaagcggtggcttacggtgccgcggtgcaggccgcc
atcctcatgggcgacacctctggaaacgtgcaggacctgctcctcctggacgtggccccg
ctgtctctgggtattgagaccgcaggtggagtcatgacagccctcatcaagcgcaacaca
accatccccaccaaacagacccagaccttcaccacttactccgacaaccagcccggcgtc
ctgatccaggtgttcgagggggaaagagccatgaccaaagacaacaacctgctgggcaaa
tttgagctgacgggaattccacctgcgccacgtggcgtcccgcagatcgaagtgaccttc
gacatcgacgccaacgggatcctaaatgtgtcggcggcggacaaaagcaccggaaaacag
aacaagatcaccatcaccaacgacaagggcaggctgagcaaagaggagatcgagagaatg
gtgcaggaggccgacaagtacaaagctgaagacgatctgcagagagagaagatttctgcc
aaaaactccctggagtcttacgccttcaacatgaagaacagtgtggaagacgacaacctg
aaaggcaagatcagcgaggaggacaagaagagggttattgagaagtgcaatgaagccgtg
agctggctggagaacaaccagctggcggataaagaggagtacgaacatcagctgaaggag
ctggagaaagtctgcaatccagtcatctccaaactctaccagggagggatgccagctgga
ggatgtggagctcaggcacgtggtgcatcaggggccagcgctcaggggcccaccattgaa
gaggtggactaa

DBGET integrated database retrieval system