KEGG   Danio rerio (zebrafish): 100137609Help
Entry
100137609         CDS       T01004                                 

Gene name
zgc:175177
Definition
(RefSeq) butyrophilin-like
Organism
dre  Danio rerio (zebrafish)
SSDB OrthologParalogGFIT
Motif
Pfam: SPRY PRY
Motif
Other DBs
NCBI-GeneID: 100137609
NCBI-ProteinID: NP_001108218
ZFIN: ZDB-GENE-080303-30
Ensembl: ENSDARG00000102296
Vega: OTTDARG00000043822
UniProt: B0JZM8
Position
7
AA seq 273 aa AA seqDB search
MDIQGFISSDSSDPWKALFITVIICALLGLAAVILYKYRSKPAGKKQAGTDCENGPVEER
KVPVNMNIEDLRKHAEQITIDRESLSPDLKVTADCKSMRDSPDYHHTAEGFPYQLCAFGA
QQFTSGRHYWEVELARENTPAKNYWLIGVVKHGNHCGKDRSALTPSCGYWFLCSDGENGF
YTNTEIPITLSISPRPERLGVLLDYDEGLLSFYSVKESKHLLTMRTRFSGSIVPLFNPGV
GDICPLKIVDCPVEEDSPAEDTEPFLKNCSADA
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atggacatacagggctttatctcctcagattcctcagacccatggaaggctctgtttatc
actgttatcatctgtgctctactgggtttggctgcagtgatcctctacaaatacagaagc
aaaccagcaggaaagaaacaagctggaacagactgtgagaatggacctgtggaggagaga
aaagttccagtaaacatgaatatagaagacctgaggaaacatgcagagcagatcactatt
gatcgtgagagtttatctccagatctgaaggttacggctgactgtaaatctatgagggac
agtccagattatcatcacactgcagaggggtttccatatcagttatgtgcatttggagcg
caacagtttacctctggacgacactactgggaggtagagctggcacgagaaaatacacct
gctaaaaactactggttaattggtgtggtgaaacatggaaatcactgtggaaaagacaga
tctgctttaactccatcatgcggttactggtttctgtgttcagatggggaaaatggcttt
tacacaaacacagaaatcccaataaccctgtccatatcaccgagacctgagcgactggga
gttctgctagattatgatgagggtctgctgtccttttacagtgttaaagagagcaaacat
ctcctgaccatgcgcactagattctctggctcaatcgttcctctgtttaatcctggtgta
ggtgacatatgtccactcaaaatagtagactgtccagtagaggaagattcacctgcagag
gacactgaacctttcctgaagaactgcagcgcagacgcctga

DBGET integrated database retrieval system