KEGG   Danio rerio (zebrafish): 100149810
Entry
100149810         CDS       T01004                                 
Symbol
mhc1lda
Name
(RefSeq) major histocompatibility complex class I LDA precursor
Organism
dre  Danio rerio (zebrafish)
SSDB
Motif
Pfam: C1-set MHC_I Ig_3 Peptidase_C28
Other DBs
NCBI-GeneID: 100149810
NCBI-ProteinID: NP_001314838
ZFIN: ZDB-GENE-140820-5
Ensembl: ENSDARG00000023203
UniProt: A0A8M1P9J3 F1RAH3
Position
25:10954770..10961324
AA seq 332 aa
MDKVLHLMLILLPAVAPKGSHSLWMHSTYIKGQTPFPEFSFVLMLDDVRVMYYNGETKNV
FPRGNATNEDDVFDLNVLRTISDKVHSSFEEKWVVATQDVNKTEVVLALQRIVGCELRHD
GKPGQMITRDAARGSTTDELLYVDKNFTYQGTLNVPAFVLNMHLKISMWNHEHLYHPFCI
KTLKGYLEKRKNQVNRKVKPKVRLLLKKLSSSFRVSCLATGFYPRHINLTLLRDGQPVSD
HDVTGGDLLPNGDGTYQMRKSLQIRAEEREKHKYTCSAKHLSLDNKLDVNLDYPGERFEP
VHSKVIVACVVGLVLLTIAGTIIECRKRKQSA
NT seq 999 nt   +upstreamnt  +downstreamnt
atggacaaggttcttcaccttatgctgattttacttccagcagttgctccgaaaggatct
cactctctgtggatgcattcaacgtacataaaaggacagactccatttcctgaatttagt
tttgtactgatgttggatgatgtcagagtcatgtactacaatggtgaaacaaaaaatgtc
tttccaagaggaaacgcaacaaatgaagacgatgtatttgatttaaatgttcttcgcaca
ataagtgacaaagtgcattcatcttttgaggaaaaatgggtagtagcaacccaagatgta
aacaaaactgaagttgttcttgcccttcagaggatagttgggtgtgaactgagacatgat
ggtaaaccaggacaaatgatcacacgtgacgctgccagaggatccaccactgatgagctg
ctatatgttgacaaaaattttacgtaccagggtactttgaacgtcccagcctttgtgcta
aatatgcatcttaaaatcagtatgtggaatcacgaacatttatatcatccattctgcatc
aaaacactcaaggggtaccttgaaaaaaggaagaatcaagtcaacagaaaagtaaaaccc
aaagtcaggcttctcttgaaaaagctgtcttctagttttcgtgtgagttgtttggcgact
gggttttaccctcgtcacatcaacctgaccctgttgagagatggacagcctgtatctgat
catgatgtcactggaggagatctgctgcccaatggagacgggacgtaccagatgaggaag
agtctgcagataagagcagaggagagagaaaaacacaaatacacctgctctgccaaacac
ctcagtctggacaacaaactggatgttaatttggattatccaggggaaagatttgagcca
gtgcattccaaggtgatagtggcttgcgtggttgggttggtgttactgaccatagctggc
actatcattgaatgcaggaagagaaagcagtcagcttaa

DBGET integrated database retrieval system