KEGG   Danio rerio (zebrafish): 100149997Help
Entry
100149997         CDS       T01004                                 

Gene name
si:dkey-23a13.1
Definition
(RefSeq) histone H2B 1/2-like
  KO
K11252  histone H2B
Organism
dre  Danio rerio (zebrafish)
Brite
Chromosome and associated proteins [BR:dre03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    100149997 (si:dkey-23a13.1)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100149997 (si:dkey-23a13.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Motif
Other DBs
NCBI-GeneID: 100149997
NCBI-ProteinID: XP_001922605
ZFIN: ZDB-GENE-160113-108
Ensembl: ENSDARG00000100259
Vega: OTTDARG00000043097
UniProt: F1QAU0
Position
7
AA seq 124 aa AA seqDB search
MPEPAKTAPKKGSKKAVTKAAGKGGKKRKRTRKESYAIYVYKVLKQVHPDTGISSKAMGI
MNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKY
TSSK
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaccagcgaagaccgcacctaagaagggctcaaagaaagcggtgactaaagcc
gctggtaaaggaggaaagaagcgcaagaggacaagaaaggagagctatgccatctacgtg
tacaaggtgctgaagcaggttcatcctgacactggaatctcctcaaaggcgatgggcatc
atgaactcgttcgtcaacgacattttcgagcgcatcgccggtgaggcttcccgtcttgct
cattacaacaagcgctccaccatcacatcgagagagatccagaccgccgtgcgtctgctg
ctgcccggggagctggccaaacacgccgtatctgagggcacaaaggccgtcactaagtac
accagctccaagtaa

DBGET integrated database retrieval system