KEGG   Danio rerio (zebrafish): 100150007Help
Entry
100150007         CDS       T01004                                 

Gene name
si:dkey-166c18.1
Definition
(RefSeq) cyclin-dependent kinase 18
  KO
K15596  cyclin-dependent kinase 18 [EC:2.7.11.22]
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    100150007 (si:dkey-166c18.1)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100150007 (si:dkey-166c18.1)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: CMGC group
  CDK family
   100150007 (si:dkey-166c18.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase Kdo Seadorna_VP7 APH Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 100150007
NCBI-ProteinID: XP_001919335
ZFIN: ZDB-GENE-141215-51
Ensembl: ENSDARG00000012204
Vega: OTTDARG00000042590
UniProt: E7F9R5
Position
11
AA seq 465 aa AA seqDB search
MNKMKNFKRRFSLSVPRTETIEENEFTEQINQLNIRCNDGVVPNSLGLHSLQPSPVAPDS
QAQSPTQLQYRNKVQHRRFSMEDVTKRMSLPMDIRLPPEFLKKLQMESPPPCKPLSRMSR
RASLSDIGFGKLETYVKLGKLGEGTYATVFKGRSKLTENLVALKEIRLEHEEGAPCTAIR
EVSLLKNLKHANIVTLHDIIHTDRCLTLVFEYLDSDLKQYLDNCGNLMSMHNVKIFMFQL
LRGLSYCHKRKILHRDLKPQNLLINDKGELKLADFGLARAKSVPTKTYSNEVVTLWYRPP
DVLLGSTEYSTPIDMWGVGCILYEMATGRPMFPGSTVKEELHLIFRLMGTPTEESWPGIT
ANEEFKSYLFPQYRAQALINHVPRLDTEGIDLLTALLLYDTKRRISAELSLRHSYFQTLG
ENILSIPDTSSVFSLREIQLQKDPGHRSSVFQPPGRGKNRRQSIF
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagatgaagaactttaagaggcgtttctcactttctgtgccacgaacagagacg
atagaggaaaacgagtttacagagcagataaaccagctcaacatccgctgcaatgatggt
gtggtgcccaacagtctgggtctacacagcctgcaacccagtccagtggctccagacagc
caggctcaatctccaacccaactacagtaccgcaacaaagtccagcaccgccgattctcc
atggaggatgtaactaagaggatgtctctgcccatggatattcgtctcccgccagagttt
ctgaagaagttgcagatggaaagcccaccgccgtgcaaacctctgagccgcatgtccaga
agagcatcgctgtcagacattggctttgggaaactggagacttatgtgaagttgggcaaa
ctaggagagggcacatatgccaccgttttcaagggtcgcagcaaactcacagaaaaccta
gtggctctgaaagagattcgtctggagcatgaagagggcgccccctgcacagccatacgg
gaagtgtcactcctgaagaacctgaaacacgccaacatcgtaacgctgcatgacatcatc
cacacggaccgatgcctcactcttgtatttgagtacctggacagtgacttgaagcagtac
ctcgacaactgtggaaacctaatgagcatgcacaacgttaagatatttatgttccagctc
cttcgcggtttatcatattgtcataagaggaagattctccaccgggacctgaagcctcag
aatctgctcattaatgacaagggagaactcaagctggcagactttggtttggccagagcg
aaatcggtcccgacaaaaacctattcgaacgaggtggtgaccttgtggtatcgaccccct
gatgttctgctgggatccactgaatactccacacccatagacatgtggggtgtggggtgt
atcctgtatgaaatggcgacggggcgacccatgtttcctggatcgactgtcaaagaggaa
ctacacctgatatttcggctcatgggcaccccaactgaggagagctggcctggaatcaca
gctaatgaggaattcaaatcctacctgtttcctcagtaccgagctcaagcgctcattaat
catgtgcccaggctcgacacggaggggatagaccttctcacagcactgttgctgtacgac
acaaagcgcaggatttcagctgaactgtctctgagacactcttacttccagaccctaggc
gagaacatcctctccatacctgacacctcatccgtgttttcactgagggagattcagcta
cagaaggatccgggacatcggagttcagtattccagcctccgggtcgaggcaagaaccgc
agacaaagcatattctga

DBGET integrated database retrieval system