KEGG   Danio rerio (zebrafish): 100150018
Entry
100150018         CDS       T01004                                 

Gene name
mhc1lja
Definition
(RefSeq) major histocompatibility complex class I LJA precursor
Organism
dre  Danio rerio (zebrafish)
SSDB
Motif
Pfam: C1-set Ig_3 TMEM154
Other DBs
NCBI-GeneID: 100150018
NCBI-ProteinID: NP_001314847
ZFIN: ZDB-GENE-140820-11
Ensembl: ENSDARG00000096830
Vega: OTTDARG00000039294
UniProt: X1WF83
Position
25
AA seq 357 aa
MSYVGNMIIILFLCVLLAPTTALTGSHSLWMLATYMKGEPYSEISITFMLDDITVGHYNS
KTERYIARHNTTNEDELTWNTFYVARHDLHTFFVRKLKFKNHTESPQLYQMMSHCELQGN
NKPGQMVSKIAFSGSTTDEMSIYENKFTYQSQKEMPSLALELIKWRHESVSYPTCISTLR
NYLKMRQTQVNRKVKPKVRLFQKANSDSGGFRVNCLATGFYPRHINLTLLRDGQPVSENE
VTGGDLLPNGDGTYQMRKSLEIRAEERQKHKYTCSAKHLSLDNKLIVTFDFDPGEPFKSV
IPSVLIILSLVLVFITGVVIYKCRKRRAVSSKRDYISASTSEESTGSTVTQPQQEAT
NT seq 1074 nt   +upstreamnt  +downstreamnt
atgtcttatgtcgggaacatgattatcatcttgtttttgtgtgtgttgttagctcctaca
actgcgttaacaggttctcactcattgtggatgcttgcaacttacatgaaaggagagcca
tattctgaaataagtatcacattcatgctggacgacataacagtaggacactataattca
aaaactgaaagatacattgcacgacataatactacaaatgaagatgagctcacttggaac
acattttatgttgcaagacatgatttgcataccttttttgtgagaaaactaaaatttaag
aaccatacagaaagtcctcaactttatcaaatgatgagtcactgtgagctacagggcaat
aacaagccaggccaaatggtttctaagattgcatttagtggctccacaacagatgaaatg
agtatttatgagaacaagtttacatatcaaagccaaaaagaaatgccaagtctggctttg
gagctaatcaagtggcgtcatgagagtgtaagctacccaacgtgcatttcaactctcagg
aattaccttaaaatgagacaaactcaagtaaatagaaaagtaaaacccaaagtcagactc
tttcagaaagcaaactcagactctggaggttttcgtgtgaattgtttggcgacaggattt
tatcctcgtcacatcaacctgaccctgttgagagatggacagcctgtatctgaaaatgag
gtcactggaggagatctgctgcccaatggggacgggacataccagatgaggaagagtctg
gagatcagagcagaggagagacaaaaacacaaatacacctgctctgcaaaacacctcagt
ctggacaacaaactcatcgtcacatttgactttgaccctggtgaaccatttaaatcagtg
attccctcagtgctgataattttgtctctggtgttggtgtttataactggagttgtcata
tataaatgcaggaaaagacgagcagtatcatctaaaagggattatatttcagcttcaacg
tctgaagaaagcactggctcaacagtaacacaaccacaacaggaagctacttaa

DBGET integrated database retrieval system