KEGG   Danio rerio (zebrafish): 100150304Help
Entry
100150304         CDS       T01004                                 

Gene name
gucy1b1
Definition
(RefSeq) guanylate cyclase soluble subunit beta-1
  KO
K12319  guanylate cyclase soluble subunit beta [EC:4.6.1.2]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00230  Purine metabolism
dre01100  Metabolic pathways
dre04270  Vascular smooth muscle contraction
dre04540  Gap junction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100150304 (gucy1b1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100150304 (gucy1b1)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100150304 (gucy1b1)
Enzymes [BR:dre01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     100150304 (gucy1b1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOBA HNOB
Motif
Other DBs
NCBI-GeneID: 100150304
NCBI-ProteinID: NP_001238874
ZFIN: ZDB-GENE-090313-160
Ensembl: ENSDARG00000086790
Vega: OTTDARG00000030229
UniProt: F1QNR4
Position
1
AA seq 608 aa AA seqDB search
MYGFVNHALELLVLRNYGPDVWEDIKREAQVDVEGQFLVRIIYEDAKTYDLVAAASKVLK
MDAGGILQMFGKMFFEFCQESGYDTILRVLGSNVREFLQNLDALHDHLGTIYPGMRAPSF
RCTDAEKGNNLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIEMKVIQPKSEECDHIKFL
IEEKDSEEEAFYEDLDGFEENGTQETRISPYTFCKAFPFHLMFDKDLMLTQCGNAIFRVL
PQLQPGVCNLSSVFSLVRPHIDFSFHGILSHINTVFVLRSKEGLLNVETAENEDELTGTE
ISCLRLKGQMISLPETENILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFR
EEYKLTQELEILTDRLQHTLRALEDEKKKTDRLLYSVLPPSVANELRHKRPVPAKRYDNV
TILFSGIVGFNAFCSKHASAEGAIKIVNLLNDIYTRFDILTDSRKNPYVYKVETVGDKYM
TVSGLPEPCTHHAKSICHLALDMMEIAGQVKVDEDPVQITIGIHTGEVVTGVIGQRMPRY
CLFGNTVNLTSRTETTGEKGKINVSEYTYRCLQSVENADPQFHLEYRGPVTMKGKKEPMK
VWFLSRKT
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgtatggttttgtgaaccacgcgttggaacttctggtgttgagaaattatggtccagat
gtgtgggaggacattaagagagaggctcaggttgatgtagagggacagtttctggtcaga
attatctatgaagatgccaaaacatatgaccttgtggctgctgcaagcaaagttctaaaa
atggatgccggtggtatcttgcaaatgtttgggaaaatgttttttgagttctgtcaggaa
tctgggtacgacaccatcctgcgagtgttgggctccaatgtccgtgaattcttacaaaat
ctggatgcattacatgaccatctgggcactatctatcctggcatgcgtgctccctccttc
cgctgcacggatgcagagaaggggaacaaccttattctccactattactctgagagagag
ggtcttcaggacatcgtcatagggatcatcaagacggttgcacagcagattcacggaact
gagattgagatgaaggtcattcagccgaagagcgaagaatgtgatcacattaagttcctg
attgaggagaaggactcggaggaggaggcgttttatgaagacttggatggttttgaggag
aatgggactcaagagacacgaatcagtccatacaccttctgcaaggcttttccctttcac
ctgatgttcgacaaggacctcatgctaacacagtgtggcaacgccatcttcagagtcttg
ccacagctgcagcctggcgtctgtaacctgtcctcagtgttctctctggttcggccgcac
atagacttcagtttccatggcatcctgtctcacatcaacactgtctttgtgctgcggagt
aaggagggcctgctaaatgtagagacggcggagaatgaagatgaactcacaggaacagag
atcagctgccttagactaaagggccaaatgatctcacttcctgagacggagaacatccta
ttcctgtgctcgccaagtgttatgaatctggatgacctgacgaggagagggctttacctg
agtgacatccctcttcatgatgccacccgtgaccttgtgttacttggggagcagtttcgt
gaggagtacaagttgacccaggagctggagatcttgacagaccgtctgcagcatacactc
cgagcactggaagatgagaagaagaagacagacaggttgctgtattctgttctgcctccg
tctgtagccaatgaactgcggcataagcggcctgtgcctgctaaacgatacgacaatgtg
accattctttttagtggcattgttggcttcaatgcattctgcagcaaacatgcatctgca
gagggagccatcaaaatcgtcaaccttctcaatgacatctacaccagatttgacattctc
actgattctcggaagaatccttatgtgtataaggtggagaccgttggtgataaatacatg
acggtgagtggtcttccagagccctgcacccaccatgcaaaatccatctgtcatctggcc
ctggatatgatggagatcgctggacaggtcaaagtggatgaggatcctgtgcagatcacc
attggaattcacacaggagaggtggtcacaggggtcataggtcaaagaatgccccgttac
tgcctgtttggaaacactgtcaatctaacaagtcgtacagagaccactggagagaaagga
aaaattaatgtgtctgaatacacatacaggtgtttgcagtctgtggaaaatgctgatcct
caatttcatttggagtacagaggacctgtaaccatgaaaggaaagaaagagccaatgaaa
gtgtggtttctctcacgcaagacttaa

DBGET integrated database retrieval system