KEGG   Danio rerio (zebrafish): 100150704
Entry
100150704         CDS       T01004                                 

Gene name
si:dkey-52k1.6
Definition
(RefSeq) gamma-aminobutyric acid receptor subunit alpha-2
  KO
K05175  gamma-aminobutyric acid receptor subunit alpha
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100150704 (si:dkey-52k1.6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:dre04040]
    100150704 (si:dkey-52k1.6)
Ion channels [BR:dre04040]
 Ligand-gated channels
  GABA-A
   100150704 (si:dkey-52k1.6)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb CytochromB561_N DUF5522
Other DBs
NCBI-GeneID: 100150704
NCBI-ProteinID: XP_009305482
ZFIN: ZDB-GENE-141216-16
Ensembl: ENSDARG00000091459
Vega: OTTDARG00000042546
UniProt: E7F635
Position
13
AA seq 451 aa
MILRRGHSHGFLIHLFLLVLWRACSEAEVSGSDAFKNNITLFTRILDRLLDGYDNRLRPG
LGDRVTEVKTDIYVTSFGPVSDTDMEYTVDVFFRQRWTDERLKFHGPMNILRLNNLMASK
IWTPDTFFHNGKKSVAHNMTMPNKLLRIMENGTLLYTMRLTVQAECPMHLEDFPMDFHSC
PLKFGSYAYTLTEVTYVWTRNATLSVEVAPDGSRLNQYDLMGQTVGKETIKSSTGEYTVM
TAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISA
RNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGWAWDGKSIVNDKKKETSVM
KKNNAYAVAVANYAPHIAKDSALPTVSKSATPEPSKAQPVAKETKKTFNSVSKIDRMSRI
IFPVLFGSFNLVYWATYLNREPVIKNMVPSP
NT seq 1356 nt   +upstreamnt  +downstreamnt
atgattctgcgacggggtcattctcacggatttctaatccacctgtttctgctggtttta
tggcgtgcatgttctgaggcagaagtatccggctcagatgcctttaaaaataacattacc
ctcttcacgcggatcttggaccggcttttggatggctacgacaacaggctgagacctggt
cttggagatcgagtgacagaggtgaagactgatatatatgtgaccagttttggaccagtg
tccgatacagacatggaatacacagtggatgtgtttttccgacagcgatggacagacgag
cggctcaagtttcacgggccaatgaacatcctgcgtctcaacaacctgatggccagtaaa
atctggactccagacactttctttcataacggcaagaaatctgtggctcacaacatgacc
atgccaaacaaactcctgcgcatcatggagaacggcaccttactctacaccatgaggttg
actgttcaagctgaatgcccaatgcatcttgaggactttccaatggatttccattcatgt
ccacttaaatttggtagctatgcgtacaccctgacagaagtgacgtacgtttggacacgt
aatgccaccctgtcagtggaagtggctccggatggatctagactgaaccagtacgatctg
atgggacaaactgttggcaaagaaaccattaagtccagcactggtgaatatacagtaatg
actgcccatttccatctgaagcggaagatcggatactttgtgatccagacgtacctgccc
tgcattatgaccgtcatcttatctcaagtctctttttggctcaacagagagtcagttccg
gcacgcacagtttttggtgtgactacagtgctaaccatgaccactctgagtatcagcgct
cgaaactctttaccgaaggtggcctatgctacagccatggactggttcatcgcagtgtgc
tacgcctttgttttctctgctctcattgagtttgccacagtgaactacttcaccaagcgc
ggctgggcctgggacggaaagagcattgtgaatgataagaaaaaagagacgtccgttatg
aaaaagaacaatgcgtatgcagtcgctgtggcaaactacgcaccccacattgcaaaggac
tctgctttgcccactgtctctaaaagcgctacaccagagcccagtaaagcacaaccggtg
gccaaagaaacaaagaagaccttcaacagcgtcagcaagatcgaccgtatgtcccgcatt
atctttccagtgctctttggcagctttaacttagtttattgggcaacatatcttaacaga
gaacctgtaattaagaacatggtaccctccccgtga

DBGET integrated database retrieval system