KEGG   Danio rerio (zebrafish): 100151215
Entry
100151215         CDS       T01004                                 
Symbol
pde7a
Name
(RefSeq) high affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7A
  KO
K18436  high affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7 [EC:3.1.4.53]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00230  Purine metabolism
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100151215 (pde7a)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     100151215 (pde7a)
SSDB
Motif
Pfam: PDEase_I
Other DBs
NCBI-GeneID: 100151215
NCBI-ProteinID: NP_001161735
ZFIN: ZDB-GENE-031222-10
Ensembl: ENSDARG00000045305
UniProt: A0A8M1NSS2 E7FFK5
Position
24:complement(24733257..24797469)
AA seq 490 aa
MELCYQLPVLPLDRPVPKHVLSRRGAISFSSSSSLFGAPDPRQLSQRRGAISYDSSDQTA
LYIRMLGDVRVRSQVGFEPERRGSHPYLGIDFRTLHSRAESAGSIPARRIRRLFSFQRHL
LSSRLLRGAPHLNPLHILDEDYCGQAKCMLEKVGSWNFDIFLFDRLTNGNSLVFLTFHLL
SQYGLIELFQLDMVKVRRFLVLVQEDYHNQNPYHNAVHAADVTQAMHCYLREPKLAQSLT
SFDILLGLLAAATHDLDHPGVNQPFLIKTNHYLAALYRNTSVLENHHWRSAVGLLRETEL
FSHLPAEDSLSIERQLGSLILATDISRQNEYLSRFRTHLDENDLNLGNASHRHFVLQMAL
KCADICNPCRPWELSKQWSEKVTEEFFHQGDIEKKLKLEISPLCDSEANTIASVQIGFMT
YVVEPLFAEWARFSDTRLSQTMLGHLGLNKASWSTMEPEASGSSEDGESDPARSSEEPSS
RALTQGSPES
NT seq 1473 nt   +upstreamnt  +downstreamnt
atggaattatgttatcagttaccggttttgcctctagacaggccggttcccaaacatgtt
ctcagccgaaggggagccattagtttcagctccagttcctctttatttggagcccccgac
ccgaggcagctgtcacagagacgtggagcaatctcctatgacagctctgatcaaaccgct
ctgtatattcgcatgctaggagatgtgagagtgagaagtcaggtaggctttgaacctgaa
cgaagaggctcgcacccatacctgggcatcgatttccgcactttgcactcacgtgctgag
tcagcagggtcgattccagctcggaggatccggaggctcttcagtttccagcgacacctg
ctctcgtcccgtctgctgagaggagcgccacacctcaaccccctccacatcctggatgag
gactactgcggtcaggccaagtgtatgcttgaaaaggttggaagctggaattttgacatt
ttcctctttgaccgacttacaaatggaaacagtctcgtcttcttgacatttcatttgctg
agccagtacggcctcatcgagctcttccagttagacatggttaaagtgcggcgatttcta
gttctggttcaagaagactaccacaatcagaacccttaccataatgcagttcatgctgct
gatgtcacccaggccatgcactgttacctgagagaacccaagctcgcccagtccctcact
tcattcgacatcctcttagggctgctggcggcggccacacacgacctggaccatcctgga
gtcaaccagcctttcctcatcaaaaccaaccattaccttgcagctttgtaccggaatacc
tcagttctggagaatcatcactggaggtcagcagtaggtttgctcagagagaccgaactc
ttttctcatcttcctgctgaggacagcttgagtattgagaggcagctgggatccctgatt
ctggccacagatatcagccgacagaatgagtacctgtcccgcttcaggacacatctggac
gagaacgacctgaatttaggaaacgcttctcatcgacacttcgttctgcagatggcgctg
aagtgtgctgatatctgtaacccgtgtcgaccgtgggagctcagcaaacagtggagtgaa
aaagtcacagaggagttcttccatcaaggtgacattgagaagaagcttaaacttgaaatc
agtccactgtgtgatagtgaagccaacaccatagccagtgttcaaatcggtttcatgacg
tacgtagtggagcctctgttcgctgagtgggctcgtttttcagacacgcggctctctcag
acgatgctcggccacctgggcctgaacaaggccagctggagcaccatggagcccgaagcg
tcgggcagctcggaggacggagaatcggatccagctcgatcctcagaagagcccagttca
agagccttaactcagggaagcccagagtcatga

DBGET integrated database retrieval system