KEGG   Danio rerio (zebrafish): 100151502
Entry
100151502         CDS       T01004                                 
Symbol
avpr2ab
Name
(RefSeq) vasopressin V2 receptor
  KO
K04228  arginine vasopressin receptor 2
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100151502 (avpr2ab)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:dre04030]
    100151502 (avpr2ab)
G protein-coupled receptors [BR:dre04030]
 Rhodopsin family
  Peptide
   Vasopressin
    100151502 (avpr2ab)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx 7TM_GPCR_Srv Orthoreo_P10 DUF5134
Other DBs
NCBI-GeneID: 100151502
NCBI-ProteinID: XP_001922042
ZFIN: ZDB-GENE-110411-48
Ensembl: ENSDARG00000029219
Position
23:18492012..18543914
AA seq 542 aa
MRIASWEDNLGQPNHSVLEMEGPPDLSSSLFNLSSSYGGTGAFLWLYPSENVTWTTMRPT
MQPVTPPRVRDQALAQAEIGVLGLVLALTALGNGFVLWVLLRRKKNHAPMHLFMVNLCVA
DLVVAFFQVLPQLVWDITERFHGPDALCRSVKYLQIVGMFASSYMIVAMTVDRHYAICCP
LQAYRGGATSRWNTPIMVAWGLAFVLSLPQVFIFSQSEVSPGVFECWGHFAEPWGLKAYV
TWMTVAVFVLPALIITVCQVRIFREIHDNIYLKSERVVTAEFKKNSVFFHFPRREGGRGR
TRKKNERSRQSRHSQQGEISLSQAHCSRSHHAGQEEFSSNLYDEYSQTLPCRSSMCEPCF
GPCPSSDPSIPNHLQNSPNNLSDPTHSQSLSANSVCALAGHTESSGASELWPDVLPDAFP
LPTEYSHPPPVPGVTKAMSKTVRMTLVIVLVYTICWSPFFIVQLWAAWDPNPPIQGAVFT
ILMLLASLNSCTNPWIYTAFSSSVSRELLALLRCHRRSPRRGSLPDDSTATHTSTNTKDS
IY
NT seq 1629 nt   +upstreamnt  +downstreamnt
atgaggatagcctcttgggaagataatttgggtcagcccaatcactctgtgctggagatg
gaggggccaccagatctgtccagctccctcttcaatctcagcagcagctatggtggtaca
ggggcttttctttggctatatccgtcagaaaatgtcacatggaccacaatgaggcccacg
atgcagccagtgacccctccaagagtgagggaccaagccttagcccaggcggagatcggg
gtactgggactggttctagccctcactgctctgggcaatggatttgtgctgtgggtgcta
ctacgtcgtaagaaaaatcacgctcctatgcacctcttcatggtcaatctgtgcgtggct
gacctggtagtggccttctttcaggtgctgccgcagctggtgtgggacatcaccgagcgc
ttccatggtcccgatgctctgtgtcgctctgtgaaatatttgcagattgtcgggatgttt
gcatcctcctacatgattgtagccatgactgtggatcggcactacgccatctgttgtccc
ctacaggcatatcgtgggggcgcaacctctcgctggaacacccctatcatggttgcatgg
ggcctggcatttgtgctcagtttaccacaggtgtttatcttctcgcagtcagaagtttcc
cccggggtgtttgaatgctggggccactttgcggagccgtggggtctgaaagcatatgtc
acctggatgactgtggctgtgtttgtattgccggccctaatcattacggtctgtcaggtt
cgcatcttcagagaaatccatgacaacatttacttgaagtcagaacgggtggtaacagca
gaatttaagaagaactcagtcttctttcactttccccggagggagggtggcaggggaagg
acgagaaagaaaaacgagagaagcagacagagcagacacagtcagcaaggcgaaatcagt
ctcagtcaagctcactgcagccgctcacatcatgctggacaggaagagttctcctcaaac
ctatatgacgaatactcgcagactttaccctgtaggagctctatgtgtgaaccctgcttt
gggccatgcccctcttcagacccttccatcccaaatcacctgcaaaacagccccaacaat
ctctcagaccccacccattctcagtcattatcagccaatagcgtgtgtgcattggctgga
cacacggagagctctggagcttctgaactatggccagatgtgcttccagatgcttttcca
cttccgaccgagtattcgcacccgccgcctgtcccgggtgtgacgaaagccatgtctaag
acggtgaggatgactcttgtcattgtgctggtctacaccatctgctggtctcctttcttt
attgttcagttatgggccgcctgggaccccaacccaccaatccaaggggctgttttcact
attctgatgctactagccagtctaaactcatgcactaacccgtggatctacacagccttc
tccagcagcgtgtcccgtgaactgctcgccctgctgcgctgccatagaagatccccacgc
cgagggtccctgccggacgactccaccgcaacgcacacatcaaccaacaccaaggactcc
atatattga

DBGET integrated database retrieval system